Write a Story Sign Up Log In
Back to Story

Chapters tagged josephine

In Dragon Age: The Blowjob Throne

  1. [Trespasser] Have a look around.

    [Trespasser] Have a look around. by CompletelyAverage

    Chapter 58

    The Council can wait. You'll spend plenty of time there once the talks get underway. For now, you merely sit back and relax as your caravan continues its parade through the Winter Palace. The streets of Halamshiral are packed with people hoping to witness your arrival. As you pa...

    20 Likes
    1,943 Views
    More Calpernia, Josephine, comedy, set up for future chapters
  2. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    725 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  3. Offer Leliana

    Offer Leliana by Derpy09

    Chapter 30

    You gaze at Grand Duke Gaspard de Chalons, a sly smile spreading across your face as you consider his proposal. Josephine's lips wrap around your cock, her tongue dancing in circles as she sucks, helping you focus on the situation at hand. You take a deep breath, savoring the sen...

    9 Likes
    634 Views
    More Dragon Age Inquisition, Leliana, Josephine, Deep throat, Blowjob, Titfuck
  4. Express your dominance

    Express your dominance by Derpy09

    Chapter 30

    You gaze at Grand Duke Gaspard de Chalons, a sly smile spreading across your face as you respond to his proposal. "My women will be available when it pleases me," you say, your voice firm and commanding. The Grand Duke's eyes narrow slightly, a hint of disappointment flickering a...

    9 Likes
    653 Views
    More Dragon Age, Inquisitor, Inquisitor Trevelyan, Josephine, Josephine Montyliet, Mind Control, Blowjob, Doggy Style, Dragon Age Inquisition
  5. Velanna is (mostly) innocent.

    Velanna is (mostly) innocent. by CompletelyAverage

    Chapter 30

    You raise your bare ass from the tree stump serving as your temporary seat of judgement and stand over the two women, your cock still slick with Knight-Captain Rylock and Velanna's combined spit as you casually stroke yourself in their faces. The silence in the clearing is palpab...

    12 Likes
    650 Views
    More Velanna, Rylock, judgement, gang bang, Vivienne, Leliana, Josephine
  6. Queen Anora must visit Skyhold.

    Queen Anora must visit Skyhold. by CompletelyAverage

    Chapter 3

    "King Alistair...” you begin, dictating your letter to the kneeling Josephine. The steady-handed diplomat manages to effortlessly transcribe your words even as you continuously coat her face with your warm spunk. “The Inquisition will aid in the capture of this Desire Demon. In...

    33 Likes
    26,765 Views
    More Queen Anora, Morrigan, Josephine, facial
  7. ... And the stick

    ... And the stick by Derpy09

    Chapter 11

    You left the Montilyet sisters gasping amidst scattered contracts and semen-smeared parchment, the throne's magic still thrumming in your veins like lyrium. Leliana awaited in your chambers, her scarlet choker gleaming against alabaster skin as she knelt beside the bed - spymaste...

    8 Likes
    447 Views
    More Leliana, Josephine

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming