Write a Story Sign Up Log In
Back to Story

Chapters tagged empress celene

In Dragon Age: The Blowjob Throne

  1. Fuck the Empress in front of her own subjects!

    Fuck the Empress in front of her own subjects! by CompletelyAverage

    Chapter 51

    Handing the warm vial of enchanted cum over to Leliana for safekeeping, you quickly turn your attention back to Celene. You smirk sadistically at the sight of once-proud Empress lying in a puddle of her own subject's spunk, her splayed body spasming with pleasure at the center o...

    12 Likes
    692 Views
    More Empress Celene, nobles, fucking, humilation, mounting, cum, domination, hard fucking
  2. Use Celene for yourself

    Use Celene for yourself by Durianmasam

    Chapter 48

    Now that you’re done with Celene’s mouth, you spin her around and her against the wall. A loud, ripping sound echoes through the Orlesian streets as you tear out the back of her dress giving you access to the royal slut's tight ass and pussy. "W-what are you doing?" the Em...

    22 Likes
    2,728 Views
    More Empress Celene
  3. Bring on the Dessert!

    Bring on the Dessert! by CompletelyAverage

    Chapter 42

    After that rousing toast from Celene, you and the other nobles return to your meals in earnest. Despite Josephine’s best attempts at teaching you the finer points of Orlesian dinner etiquette, you still wolf down your roast pheasant and spice potatoes with all the grace and soph...

    26 Likes
    2,321 Views
    More Empress Celene, Briala, Cassandra Pentaghast, face-fuck, elven servants, cum on food, comedy, deep throating, under the table, nobles
  4. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    725 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  5. The Winter Palace

    The Winter Palace by Derpy09

    Chapter 29

    Your entourage finally reaches the Winter Palace. Fancy dressed nobles offer their respect, as they should. You exit your carriage, with Josephine on your arm, dressed in her new outfit. Everyone is mesmerized by her and the other women of the Inquisition, who have been dressed f...

    9 Likes
    818 Views
    More Josephine Montilyet, Mind Control, Orlais, Empress Celene, Bryala
  6. He does

    He does by Derpy09

    Chapter 36

    Briala, her white masque and headdress the only adornments on her otherwise naked body, kneels before Ser Michel de Chevin. Her movements are fluid and graceful, like a predator stalking its prey. She reaches up, her fingers trembling slightly as they undo the laces of his pants....

    5 Likes
    278 Views
    More Empress Celene, Briala
  7. Arrive at the Winter Palace!

    Arrive at the Winter Palace! by CompletelyAverage

    Chapter 34

    The rest of your journey to the Winter Palace proves uneventful, the full garrison of soldiers surrounding your caravan making for a powerful deterrent against any petty roadside bandits. The "souvenirs" of your journey, Velanna and Captain Rylock stumble behind your carriage in...

    13 Likes
    223 Views
    More Cassandra Pentaghast, Vivienne, Josephine Montilyet, Empress Celene, Briala, humor, mind control

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming