Write a Story Sign Up Log In
Back to Story

Chapters tagged double blowjob

In Dragon Age: The Blowjob Throne

  1. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    725 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  2. Let's explore the camp!

    Let's explore the camp! by CompletelyAverage

    Chapter 31

    The scene unfolds before you as you stroll through the burgeoning campsite. Josephine supervises the gaggle of soldiers tasked with unloading your luggage, their faces contorting and backs bowing under the sheer weight of your belongings, while your ambassador keeps everything ac...

    11 Likes
    494 Views
    More Vivienne, Cassandra Pentaghast, Josephine Monilyet, double blowjob, dinner, human furniture, Scout Harding, blowjob, facesitting
  3. Josephine succeeds!

    Josephine succeeds! by the_high_king

    Chapter 7

    It take's a whole lot of effort but Blackwall manages to shove and slide his cock right next your cock, filling the noblewoman's face to it's limit. Josephine strained to breathe, her cheeks bulging out like a squirrel with nuts as two men fucked her mouth at the same time. The...

    10 Likes
    21,351 Views
    More double blowjob, double barrel blowjob, straight frottage, double blowjob, double barrel blowjob, straight frottage
  4. Attend the War Table meeting.

    Attend the War Table meeting. by CompletelyAverage

    Chapter 5

    Finished with your meal, you exit the tavern. You barely make it two steps into the courtyard before you hear loud moaning coming from above you. Sitting on the roof of the Herald's Rest, a bottle of wine in one hand and the other plunged down the front of her plaid tights is Ser...

    31 Likes
    10,991 Views
    More Leliana, Josephine Montilyet, double blowjob, ffm, cock worship

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming