Write a Story Sign Up Log In
Back to Story

Chapters tagged comedy

In Dragon Age: The Blowjob Throne

  1. [Trespasser] Have a look around.

    [Trespasser] Have a look around. by CompletelyAverage

    Chapter 58

    The Council can wait. You'll spend plenty of time there once the talks get underway. For now, you merely sit back and relax as your caravan continues its parade through the Winter Palace. The streets of Halamshiral are packed with people hoping to witness your arrival. As you pa...

    20 Likes
    1,943 Views
    More Calpernia, Josephine, comedy, set up for future chapters
  2. Bring on the Dessert!

    Bring on the Dessert! by CompletelyAverage

    Chapter 42

    After that rousing toast from Celene, you and the other nobles return to your meals in earnest. Despite Josephine’s best attempts at teaching you the finer points of Orlesian dinner etiquette, you still wolf down your roast pheasant and spice potatoes with all the grace and soph...

    26 Likes
    2,321 Views
    More Empress Celene, Briala, Cassandra Pentaghast, face-fuck, elven servants, cum on food, comedy, deep throating, under the table, nobles
  3. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    725 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  4. Visit Dagna in her undercroft.

    Visit Dagna in her undercroft. by CompletelyAverage

    Chapter 27

    If your previous trips to the Winter Palace were any indication, it wouldn't hurt to stock up on weapons and armor before you leave. With that in mind, it's time to pay your resident arcanist Dagna a little visit. As you stagger through the dank, dimly lit tunnels of Skyhold's u...

    25 Likes
    3,115 Views
    More Dagna, magic, strap on, comedy
  5. Merrill

    Merrill by Kiasyon

    Chapter 21

    "...Merrill, one of Varric's friends from Kirkwall," Josephine says. You peer up from Krem's head bobbing on your cock to a somewhat petite elf standing next to Josephine. You survey her from your elevated position and something....changes. You tap Krem's head to signal him to...

    24 Likes
    3,381 Views
    More Merrill, semi-serious arc, comedy
  6. Scout Harding!

    Scout Harding! by CompletelyAverage

    Chapter 21

    "...Lace Harding, lead scout of the Inquisition." Josephine finishes. "Howdy, Your Worship!" the redhead dwarf cheerfully waves as she waddles up to the throne. Normally this is where a kiss of your cock would occur but with Krem hogging your entire shaft to himself at the momen...

    16 Likes
    3,596 Views
    More Scout Harding, willing cum dump, female dwarves, comedy
  7. Scout Harding!

    Scout Harding! by CompletelyAverage

    Chapter 19

    As your guards escort the dejected Morrigan out of your chambers, you begin to consider your choices for her replacement. You may have, in fact, relieved the witch of her cocksleeve duties prematurely as you tend to think clearest with a mouth wrapped around your cock but you're...

    17 Likes
    767 Views
    More Scout Harding, Lace Harding, cocksleeve, blowjob, cock on face, dwarven, comedy
  8. Add your special ingredient to Sera's cookies.

    Add your special ingredient to Sera's cookies. by CompletelyAverage

    Chapter 16

    “Everyone knows you prefer munching carpet, Sera.” you chuckle, tapping your swollen cock against the elf's freckled cheeks for sarcastic effect. Thanks to your throne's persistent magic, the lesbian rogue doesn't bat an eyelash at any of this. "Right, yea?" she half-grins. "Wou...

    35 Likes
    3,451 Views
    More Sera, face fucking, cum on food, comedy
  9. They've found the assassin! Tallis!

    They've found the assassin! Tallis! by CompletelyAverage

    Chapter 12

    “Your Worship,” Leliana addresses you. “We've apprehended the assassin hiding in Skyhold.” “Maker, that was quick.” you chuckle, sitting up in your throne. It seems your decision to pair Bull and Leliana together on this mission paid off. "Bring this assassin before me for judgm...

    18 Likes
    2,696 Views
    More Tallis, Leliana, Iron Bull, comedy, elves
  10. Dorian and Mother Giselle!

    Dorian and Mother Giselle! by CompletelyAverage

    Chapter 6

    The climb up the winding stairs is unremarkable until you reach the landing, where you soon discover a heated exchange between Dorian and Mother Giselle that's impossible to ignore. Dorian, his usually charming composure slightly ruffled, wears an expression of thinly veiled exas...

    11 Likes
    816 Views
    More Dorian, Mother Giselle, cock slapping, conflict resolution, humor, comedy, face fucking
  • «
  • »

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming