Back to Story

Chapters tagged massage

In Women Want You Naked

  1. Teacher strips you in front of class

    Teacher strips you in front of class by bluebat

    Chapter 8

    Ms Orwin just pulled off the blanket that you were covering yourself with. You are now presenting your nude body, ass first to the rest of the class, as you and teacher are still standing pressing your bodies into one another. "See... this is no big deal!" Ms Orwin whispers into...

    29 Likes
    3,431 Views
    massage, cfnm, precum, erection
  2. A Massage Class

    A Massage Class by dbzzzzz

    Chapter 2

    You push the door open and step into the warm haze of eucalyptus oil and low lamplight. It’s the same room you’ve been coming to for weeks now—rows of padded tables, little carts of oils and towels, the faint hum of a diffuser in the corner. But today feels different. The air has...

    9 Likes
    1,498 Views
    enm, cfnm, oon, class, massage
  3. The girls get massaged

    The girls get massaged by dbzzzzz

    Chapter 3

    Camille’s smile has that soft steel in it again as she gathers you around the tables. “Today,” she says, braid brushing her shoulder as her eyes sweep over each of you, “is the final practicum. We’ll rotate, everyone receiving a full-body sequence. Real skin, real muscle, real t...

    12 Likes
    786 Views
    massage, enm, cfnm
  4. Hands on Learning

    Hands on Learning by dbzzzzz

    Chapter 10

    Camille’s eyes linger on your cock, slick and flushed, before she straightens. Her braid slides over her shoulder as she addresses the room. “Module three: manual release. This one is simple—hand-to-skin. It is up to the therapist how far she wishes to go. Some stop at stroking....

    12 Likes
    556 Views
    cfnm, enm, oon, massage, edging

Tags

enmcfnmembarassed masturbationembarassed erectionorgasm at dinnerfootjobthe only one nakednaked mealHandjobfemdomnude in publicnaked for dinnernaked at a restaurantnude diningplease stay nakedoonembarrassed nudenaked first datestolentowelnudeofficestrippedexhibitionistembarrassmentpoolbig erectionerectionsembarrassing erectionpublic nude erectionnaked in front of a crowdvideorecordedtiedrestrainedunable to covercollegeseniorpublic nudityhumiliationexhibitionsitexhibitionismfirst datenaked on a dateerectionpublic erectionerect penisvisible shaftarousal in publicnaked erection in publicuncoverednaked in public on a first date with a huge bonernude dateNude MaleNude FemaleNFNMNude modellingYoure NakedTeacherHard PenisErection while modellingprecumbonerhard dickabout to cumteasingnude musemale musemodelling nakednaked malenaked in schoolnaked in classarousalhard-onnaked for teacherembarrassed maleclothed female naked maleonly one nakedassisted exposureflirty girlsexcited classmateswagerbetlost betfantasyknightexhibitionsmcolleaguenaked in publicworkplacerurallibrarianembarrassed naked malesFarmFarmerAPHAverage dickaverage penisaverage cocklost betsbetsstripstripped in schoolstripped by classmatesnaked in front of everyonemassagehigh school nudephotophotoshootclasscoedexhibtionistPre-marital hand holdingnakeddinner nakednude modelnaked for a crowdnaked in front of crushshy posingembarrassed nude malenaked at schoolnaked outdoorsnaked in front of teacherraging public bonerNude outdoorserection in publicmale orgasmorgasm in front of everyonecumming in publicnude at dinnerclothed females nude malenipnude and aroused in publichigh schoolstreakingoutdoorsnuditynaked outsidecafesex at schoolfucking a crushfucking outdoorssex in publicmale nudewet and nakedpublic arousalaccidental public nudityBottomlesssudden nudityGrocery storestageedgingpublicmagicembarrassed erectionflinging precumthrobbing bonerAsian girlslegalHRmuseillustrationanxietyGymprincesscastlelobbyhotelFondlingSpankinghigh school girlsexcited girlsshy guythreat of exposureCasual NudityHome NudismNudismNudistHome NudistNaturismNaturistTopfreedomTopfreeToplessPublic ExposurePublic BonerBouncing PenisBouncing BallsBouncing BonerPrePre-CumMale NudityMale ExhibitionistMale ExhibitionismHeight DifferenceBarefootBare FeetFlashingclothed teacher nude studentnude in classoutdoor nudetowelwaiterpose nudedrawing your nude bodyoogling girlsnude in front of groupblack girlemo girlasian girlflirty teacherhardmake-outkissingcaughtnaked at the officeflirty classRISKYCLOTHES STOLENSHARED BEDRISKY ERECTIONRISKY BONERHARD COCKRomanceDatingCoupleNaked BoyfriendEmbarrassed Naked MaleZenraExposedStrippingClothed Female Nude MaleClothed Female Nakek MaleExposureHuge BoobsBig TitsLarge BreastsBustyBuxomSouthern BelleGirlfriendwatching you undressraging bonershy nudechoose to stripstripping for classEdgedRISKY NUDITYhandcuffpictureorgasm controlteacher crushalone with teacherworkout without clothesBarefoot teacherNude exercisenude in front of teachernude in schoolclassmates touchingmale arousedthrobbingnude in front of classassisted nudeshaftmale bodyembarassed arousalnude at workphotograheroiledarrogantexhbitionistteasedcumoralblow jobsex with teachersex in schoolAccidental NudityNude posingnaked teacherlife drawinghazingrushgamehandsyphotographyuncontrolled thustingstrokingaccidental cummingorgasm in classfootfetishbachelorette partypokersupportivenaked in the sunwet pantieswet bonercrossoverpicturescmnfgrindingbreast suckingprofessorMILFBoobiehugBreath SmotherMarshmallow HellBreastplayDirty Talkmagical kingdomqueenAsianGlassesHeadpatsBack RubsPublic Sexcum competetionteacher approved nudityoutdoor nude photoshootstrip gamereality tvvoyeursex during photoshootteacher giving headpublic sex with teacheroral in publicoral in classpenis sneaks into mouthphotographedmasturbationinterng stringshowtv showreality showcheerleadersmissing clothesenfonly maleAss SqueezeBreast Grabdripping erectionmale modelnude in art classcoffeelegally nudenude in officedeliveryoffice oonbossemployeestrip pokerorgasmpublic orgasmimposed orgasmWet spotwet penisVisible erectionfilmedphotographerspeedonaked in officeHugsHuggingSnugglingCuddlesLap SittingSitting in LapMommy DomSoft DomGentle DomBBWBlondeFrecklesTHICCcockringcock ringpenis measuringpenis measuredmeasuredmeasuringpenis sizepenile lengthpenis exposurenaked at dinnerfeetexposed arousalhuge erectionaroused in publicnaked and aroused in publicideassororityedgeoffice nudityswimsuitLatinaMexicanabondagenaked in front of strangerstouchy classmatesconcealment is futileclothed females naked malenaked in a crowdencouraged nakedashameddefeated shamenude guiltnude at schoolclothing breaknude in highschoolclothes falling offdisrobeclothing falls offaccidental nudeembarassing nude drawingswitchesstrokedEx-girlfriendskinnydippingdreammeasurementerectpantsedcocknaked in front of classthrobbing penisnude for everyonechoiceSubmissivepublic nudenaked on public beachunwanted orgasmboss makes you cumstripped by bosscrowd of onlookerscum in mouthcum spraycum tornadocum blizzardgiant orgasmclimaxcum on teachercum on classmatestvfacialsunblocksunscreenstreakphotocopyexhbitioinistcosplayroleplayFlat ChestSmall TitsNerd GirlRedheadblowjobdominationmodelworkstripped in publicnaked in front of classmatesundressing in classswimwearbargainShortstackCuddlingnaked on a first daterural nudeWet DreamMorning Wood