Write a Story Sign Up Log In
Back to Story

Chapters tagged josephine montilyet

In Dragon Age: The Blowjob Throne

  1. Quality time with Josephine!

    Quality time with Josephine! by CompletelyAverage

    Chapter 31

    Your convoy of carriages, mounted cavalry and foot soldiers maintain their well-ordered pace as you descend down the Frostback Mountains. The battle nugs keep up easily with the horses, their Volcanic Aurum armor specifically enchanted by Dagna to increase their stamina tenfold w...

    32 Likes
    2,360 Views
    More Josephine Montilyet, rough, blowjob, face-fucking, throat fuck
  2. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    725 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  3. Make Josephine dance for you

    Make Josephine dance for you by Derpy09

    Chapter 27

    As Josephine finished speaking, she couldn't help but glance down at the revealing outfit in her hands, her face still flushed with embarrassment. You let out a chuckle, the sound rumbling deep within your chest. "Before we attend the Empress's ball, I think it would be fitting...

    13 Likes
    748 Views
    More Dragon Age, Dragon Age Inquisition, Josephine Montilyet, Harem girl, Dance, Blowjob, Pussy, Harem Dancer, Mind Control, Sensual Dance
  4. Collar the eager slut

    Collar the eager slut by Derpy09

    Chapter 28

    Seeing the beauty and the sexual skill of Josephine combined with the enticement of her outifit gives you an idea to better show off your power as Inquisitor. You have two golden rings attached to the Throne, connected to chains of the same material. You take Josephine, which is...

    8 Likes
    693 Views
    More Dragon Age, Dragon Age Inquisition, Josephine Montilyet, Harem girl, Dance, Blowjob, Pussy, Harem Dancer, Mind Control, Sensual Dance, Morrigan, Chaines, Collars
  5. The Winter Palace

    The Winter Palace by Derpy09

    Chapter 29

    Your entourage finally reaches the Winter Palace. Fancy dressed nobles offer their respect, as they should. You exit your carriage, with Josephine on your arm, dressed in her new outfit. Everyone is mesmerized by her and the other women of the Inquisition, who have been dressed f...

    9 Likes
    822 Views
    More Josephine Montilyet, Mind Control, Orlais, Empress Celene, Bryala
  6. Arrive at the Winter Palace!

    Arrive at the Winter Palace! by CompletelyAverage

    Chapter 34

    The rest of your journey to the Winter Palace proves uneventful, the full garrison of soldiers surrounding your caravan making for a powerful deterrent against any petty roadside bandits. The "souvenirs" of your journey, Velanna and Captain Rylock stumble behind your carriage in...

    13 Likes
    226 Views
    More Cassandra Pentaghast, Vivienne, Josephine Montilyet, Empress Celene, Briala, humor, mind control
  7. Return to the main hall where Josephine has a problem!

    Return to the main hall where Josephine has a problem! by CompletelyAverage

    Chapter 22

    Returning to normal business, you elect to make the rounds and check on your companions. After visiting the tavern for a few drinks, some lively conversation and a fair amount of throat fucking the serving wenches, you make your way back to the throne room. You decide to pop int...

    26 Likes
    2,556 Views
    More Josephine Montilyet, Yvette Montilyet, Leliana, set up for future chapters, blowjob
  8. To the War Room!

    To the War Room! by CompletelyAverage

    Chapter 21

    With Harding in tow, you lumber out of your chambers and begin the long trek towards the War Room for your meeting. You stroll the hallways of Skyhold, your cock swinging freely between your thighs as Harding trots faithfully beside you, her cheeks flushing red as she tries to i...

    10 Likes
    405 Views
    More Scout Harding, Cullen Rutherford, Leliana, Josephine Montilyet, blowjob, face fuck, under the table, cumshot, free use, fantasy, dwarf
  9. Interrupt a romantic candlelit dinner.

    Interrupt a romantic candlelit dinner. by CompletelyAverage

    Chapter 14

    The heavy wooden doors of the Herald's Rest swing inward as you stride into the tavern, the cacophony of drunken revelry washing over you like a tidal wave on the Waking Sea. Skyhold's favorite fuck den is as lively as ever as soldiers spill drink and spunk in near equal measure,...

    14 Likes
    523 Views
    More Josephine Montilyet, Blackwall, romance, dinner scene, free use, blowjob, face fuck, face fucking, throat fuck, cum swallowing, cuckolding, cuckold
  10. Sit in Judgement!

    Sit in Judgement! by CompletelyAverage

    Chapter 11

    "Your Worship, there are prisoners awaiting your judgment." Josephine dutifully informs you, consulting her trusty ledger. To her credit, your ambassador always tried to maintain the illusion of a schedule even when your perverted distractions made keeping to a tightly-crafted i...

    17 Likes
    731 Views
    More Josephine Montilyet, Morrgian, Florianne de Chalons, judgement, blowjob, face fucking, humor, free use
  • «
  • »

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming