Write a Story Sign Up Log In
Back to Story

Chapters tagged comedic orgasm

In Dragon Age: The Blowjob Throne

  1. The Palace Gardens.

    The Palace Gardens. by CompletelyAverage

    Chapter 55

    Stepping out from a sea of mingling nobles and onto the terrace, you draw your first breath of fresh air in what feels like hours. The pleasant aroma of wildflowers is a marked improvement over the thick cloud of flop sweat and stale perfume currently polluting the royal ballroom...

    22 Likes
    1,597 Views
    More Sera, pussy eating, cunnilingus, face-riding, squirting, comedic orgasm
  2. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    726 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  3. No

    No by Kiasyon

    Chapter 18

    When you get up to Sera's room you find the door locked. You try the handle, stuck. Give it a push, stuck. You think about magic, but it's just a door and Sera doesn't seem to be the one to do her business with an audience like you. You decide to get something to eat and sit at...

    16 Likes
    3,053 Views
    More comedic orgasm
  4. Take a walk

    Take a walk by Kiasyon

    Chapter 16

    When you return to the hall you see some sex is still going on! Anora's handmaidens are bent over the tables as Inquisition workers fuck their holes like their Queen. The ladies were moaning in ecstasy as the men pound them and it does you good to see things are still going witho...

    21 Likes
    5,626 Views
    More squirting, comedic orgasm, elbow deep in consequences

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming