Write a Story Sign Up Log In
Back to Story

Chapters tagged cassandra pentaghast

In Dragon Age: The Blowjob Throne

  1. Have a bath before dinner.

    Have a bath before dinner. by CompletelyAverage

    Chapter 40

    While you await Cassandra's return, you decide to make yourself at home in your new suite. On the table, you find a woven basket filled to the brim with all manner of Orlesian delicacies. Between all the fresh-picked fruit, artisan cheese, and gourmet chocolate, there's enough f...

    33 Likes
    3,175 Views
    More bath, handjob, blowjob, Cassandra Pentaghast, elven servants
  2. Divine Victoria (Cassandra)

    Divine Victoria (Cassandra) by CompletelyAverage

    Chapter 59

    You wander through the opulence of the Winter Palace on your way to meet one of the principals of this Exalted Council, Divine Victoria, or, as you knew her back in the Inquisition, Seeker Cassandra Pentaghast. Truthfully, Cassandra was never your first choice to become the next...

    13 Likes
    674 Views
    More Cassandra Pentaghast, Divine Victoria, blowjob, facefucking, fucking, cum swalowing, voyeurism, Trespasser
  3. Cassandra!

    Cassandra! by CompletelyAverage

    Chapter 51

    You're pleasantly surprised to find your next partner is your bodyguard, Cassandra Pentaghast. Being your official "date" for the ball, Cassandra had become quite the popular dance partner, second only to the Empress herself in the number of men lining up to share the floor with...

    21 Likes
    2,357 Views
    More Cassandra Pentaghast, dancing, face-fucking, squirting
  4. Bring on the Dessert!

    Bring on the Dessert! by CompletelyAverage

    Chapter 42

    After that rousing toast from Celene, you and the other nobles return to your meals in earnest. Despite Josephine’s best attempts at teaching you the finer points of Orlesian dinner etiquette, you still wolf down your roast pheasant and spice potatoes with all the grace and soph...

    26 Likes
    2,322 Views
    More Empress Celene, Briala, Cassandra Pentaghast, face-fuck, elven servants, cum on food, comedy, deep throating, under the table, nobles
  5. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    725 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  6. Let's explore the camp!

    Let's explore the camp! by CompletelyAverage

    Chapter 31

    The scene unfolds before you as you stroll through the burgeoning campsite. Josephine supervises the gaggle of soldiers tasked with unloading your luggage, their faces contorting and backs bowing under the sheer weight of your belongings, while your ambassador keeps everything ac...

    11 Likes
    497 Views
    More Vivienne, Cassandra Pentaghast, Josephine Monilyet, double blowjob, dinner, human furniture, Scout Harding, blowjob, facesitting
  7. Start your morning with a blowjob!

    Start your morning with a blowjob! by CompletelyAverage

    Chapter 33

    The morning sun bleeds through the canvas of your tent, assaulting your sleep-crusted eyelids with its blinding light until you're pulled from your deep, snoring slumber. You let out a grunt, shifting your massive weight, the sheets beneath you still damp with sweat and scented o...

    10 Likes
    398 Views
    More Cassandra Pentaghast, blowjob, throat fuck, handjob, free use, mind control, power play, face fucking, masturbation
  8. Arrive at the Winter Palace!

    Arrive at the Winter Palace! by CompletelyAverage

    Chapter 34

    The rest of your journey to the Winter Palace proves uneventful, the full garrison of soldiers surrounding your caravan making for a powerful deterrent against any petty roadside bandits. The "souvenirs" of your journey, Velanna and Captain Rylock stumble behind your carriage in...

    13 Likes
    226 Views
    More Cassandra Pentaghast, Vivienne, Josephine Montilyet, Empress Celene, Briala, humor, mind control
  9. Cassandra could use a good fuck.

    Cassandra could use a good fuck. by CompletelyAverage

    Chapter 17

    Between the Chantry pressuring her to seek the empty Sunburst Throne and the revelations of corruption within her Order of Seekers, Cassandra has been under considerable stress as of late. Taking a ride on a Grey Warden's huge cock might be just the thing she needs right about no...

    20 Likes
    2,639 Views
    More Cassandra Pentaghast, Blackwall, Iron Bull, romance, cunnilingus, pussy eating, creampie, bukkake, tavern sex
  10. She chickens out, but Iron Bull goes for Plan B

    She chickens out, but Iron Bull goes for Plan B by AmberTrans

    Chapter 7

    With her vision entirely filled with the massive Qunari's more than proportional cock, Cassandra Pentaghast seems more terrified than she's ever been in her life. She struggles for a moment, torn between obeying the Inquisitor and becoming a lowly Qunari mercenary's cocksleeve, b...

    20 Likes
    26,334 Views
    More Cassandra Pentaghast, Iron Bull, Anal, Cassandra Pentaghast, Iron Bull, Anal
  • «
  • »

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming