Write a Story Sign Up Log In
Back to Story

Chapters tagged blowjob

In Dragon Age: The Blowjob Throne

  1. Introduction

    Introduction by the_high_king

    Chapter 1

    You are the **Herald of Andraste** and the **Inquisitor** of _'The Inquisition'_... a fat, corrupt balding man who has the power to close the demonic rifts that plague the land of Ferelden. You're definitely not the hero that the people were expecting but currently they have no o...

    150 Likes
    388,080 Views
    More bdsm, blowjob, oral sex, fantasy, rough, gag, gagging, throatfuck, MF, domination, BDSM, facials, cumshots, dwarven females, dwarves, elves, voyeur, humiliation, oral, qunari, mage, bukkake, blowbang, fan-fiction, fanfiction, gaming
  2. Have a bath before dinner.

    Have a bath before dinner. by CompletelyAverage

    Chapter 40

    While you await Cassandra's return, you decide to make yourself at home in your new suite. On the table, you find a woven basket filled to the brim with all manner of Orlesian delicacies. Between all the fresh-picked fruit, artisan cheese, and gourmet chocolate, there's enough f...

    33 Likes
    3,176 Views
    More bath, handjob, blowjob, Cassandra Pentaghast, elven servants
  3. Schmooze with the nobles.

    Schmooze with the nobles. by CompletelyAverage

    Chapter 41

    Navigating the maze of grand hallways, you eventually come upon the courtyard. It's here you discover the royal garden filled to the brim with socializing nobles. The sun has yet to even set and already most of the guests appear drunk. Scanning the crowd, you spot some familiar f...

    34 Likes
    2,764 Views
    More Vivienne, Madam de Fer, face fucking, blowjob
  4. Divine Victoria (Cassandra)

    Divine Victoria (Cassandra) by CompletelyAverage

    Chapter 59

    You wander through the opulence of the Winter Palace on your way to meet one of the principals of this Exalted Council, Divine Victoria, or, as you knew her back in the Inquisition, Seeker Cassandra Pentaghast. Truthfully, Cassandra was never your first choice to become the next...

    13 Likes
    683 Views
    More Cassandra Pentaghast, Divine Victoria, blowjob, facefucking, fucking, cum swalowing, voyeurism, Trespasser
  5. The Eluvian is acting strange.

    The Eluvian is acting strange. by CompletelyAverage

    Chapter 53

    You arrive at the gates of Skyhold where, for the moment, everything appears to be normal. The guards manning the tower release the drawbridge, its wooden frame buckling under the weight as your overburdened caravan enters the mountain fortress. Reaching the inner courtyard, you...

    20 Likes
    1,767 Views
    More Morrigan, Eluvian, Sera, blowjob
  6. Wine and Cheese

    Wine and Cheese by CompletelyAverage

    Chapter 41

    You and Vivienne stroll arm-in-arm through the winding halls of the Winter Palace, the enchanter's slender arm looped delicately around your flabby one like a silk ribbon tied around a sweaty Bronto hock as you navigate the gilded labyrinth together. The contrast between you two...

    13 Likes
    404 Views
    More Vivienne, Madam de Fer, blowjob, Orlais, Winter Palace, nobles, free use
  7. Quality time with Josephine!

    Quality time with Josephine! by CompletelyAverage

    Chapter 31

    Your convoy of carriages, mounted cavalry and foot soldiers maintain their well-ordered pace as you descend down the Frostback Mountains. The battle nugs keep up easily with the horses, their Volcanic Aurum armor specifically enchanted by Dagna to increase their stamina tenfold w...

    32 Likes
    2,362 Views
    More Josephine Montilyet, rough, blowjob, face-fucking, throat fuck
  8. Rough roads ahead!

    Rough roads ahead! by CompletelyAverage

    Chapter 32

    The phrase "time flies when you're having fun" rings true as the next few hours pass you by quickly. By now, you've left Skyhold and the Frostbacks far behind, the snow-capped peaks that once dominated the view from your carriage windows now fully replaced by miles and miles of g...

    21 Likes
    728 Views
    More Josephine Montilyet, Josephine, Cassandra Pentaghast, wrong hole, surprise anal, porn plot, double blowjob, blowjob, tit fuck, dream sequence, bumpy ride, comedic orgasm, Briala, Empress Celene, comedy
  9. "One sloppy blowjob, please!"

    "One sloppy blowjob, please!" by CompletelyAverage

    Chapter 28

    Having fully perused Bonny's goods, it's time to sample her services—one service in particular. The kind of service reserved for fat, perverted bastards with Throne's full of ancient sex magic. "Your finest blowjob, please," you smirk, casually stroking your cock in front of the...

    13 Likes
    913 Views
    More Bonny Simms, blowjob, throatfuck
  10. Pay a visit to the stables.

    Pay a visit to the stables. by CompletelyAverage

    Chapter 27

    Before embarking on your journey, it might be wise to inspect the mounts you'll be counting on to haul your orgy on wheels to the Palace. With that, you head off to meet Horsemaster Dennet. For nearly thirty years, Dennet had served as the horse master to Arl Eamon before retiri...

    19 Likes
    1,908 Views
    More Seanna, blowjob, face-fuck
  • «
  • »

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

orgybukkakeScout HardingBlackwallIron BullDorianKremSeraCalperniaJosehpine Montilyettitjobboobjobmasturbationdeepthroattraingangbangpublic usecum in foodcum on foodMerrillwilling cum dumpfree usestockspilloryface-fuckingspit-roastingGattCassandrafight sceneinterracialbreedingEmpress CeleneMorriganEluvianblowjobtransition wooshViviennespa daycum facialMadam de FerJosephine MontilyetMind ControlOrlaisBryalaCassandra PentaghastBrialahumorVarric TethrasMarian HawkeHawkespitroastgaggingImpregnationroughthroat fucksilk dancerface fuckingcomedydress upJosephinewrong holesurprise analporn plotdouble blowjobtit fuckdream sequencebumpy ridecomedic orgasmVelannaRylockjudgementgang bangLelianaJosephine MontylietDragon Agecreampiecum dumpdemonessdemonsBonny SimmsthroatfuckFlissaCabotMarydenColetavern sceneface-fucksquirtingelbow deep in consequencesTallisstockadessexual dominationmind breakface fuckanalrough anallubeDPdouble penetrationrimjobunder the tablerough sexahegaoEnchanter FionaHelismaClemenceTranquil sexemotionless sexmain storyfoursomedoggystyleorgasmDragon Age InquisitionDeep throatTitfuckMale InquisitorDagnastrap-onplotInquisitorInquisitor TrevelyanDoggy StyledancingJosephine Monilyetdinnerhuman furniturefacesittingDorian Pavusffmcock worshipelven servantsdeep throatingnobleshandjobpower playBonny SimsmerchantQueen AnorafacialpublicYvette MontiliyetLace Hardingcocksleevecock on facedwarvenmagestemplarhelping handspankingbreakfastSister NatalieChantry SisterCharterpussy eatingcunnilingusface-ridingYvette Montilyetset up for future chaptersbattle scenegroupcum covered fuckingWinter PalaceCullen Rutherfordcumshotfantasydwarfmindbreakhard fuckingHarem girlDancePussyHarem DancerSensual DanceChainesCollarsSeannaMorrgianFlorianne de Chalonsromancedinner scenecum swallowingcuckoldingcuckoldtransformationgender bendDuchess Floriannetavern sexMother GiselleprositutionHerah AddarQunarisemi-serious arcrough fuckingEnlargementBEPEfuckinghumilationmountingcumdominationdouble barrel blowjobstraight frottageExperimentsmagicstrap oncock slappingconflict resolutionfemale dwarveselvesbathcum swappingDivine Victoriafacefuckingcum swalowingvoyeurismTrespasserbdsmoral sexgagMFfacialscumshotsdwarven femalesdwarvesvoyeurhumiliationoralmageblowbangfan-fictionfanfictiongaming