• Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
    • Sign Up
    • Log In
  • Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
Write Sign Up Log In

Story tags

Filter the chapter branches in this story.

bdsmFemdomsissybondageChastitygaylesbianLatextrapCollegefemboyHumiliationsexfightPuppy playFfmfutatruth or darewrestlingcrossdressermale subHorrorpredatorpreyrubberFutanariBlowjobHuntPet playCrossdressingfetishfeminizationwagershemalebetpony playpublichypnosisBrotherspegginglezdomescape roomLocktobercuckhighschoolMaledomStraponpup playServantOfLilithftmofficeFutadompublic humiliationgagLost betFemalesisterleathermaidPredatororgasm denialtwinsGloryholedareMedicalMermaidPreyFox playedgingmind controlhypnotismSexual wagerbitwinktrapdomchristmasBrothertrapxtrapPrimalpetplayfarm playBethanfetish wearsex fight69mixed wrestlingdickgirlRiddleGame nightcosplaythreesomeTeenpuppyplaysororityhigh schoolSistersT4TLiving latexBad endingRole reversalSupernaturalsuccubusDeRoeForestCarDungeonGenderfluidpredicament bondageSpankingSmotheringsexual betsGamePunkJobAmnesiahaunted housefemale subzoomachinelesdombunny boyfox huntmachine playMachine fuckingmazeschooldemonBlackDoorMansionFoliageSensesnuntrap x trapRopeshemale x maletoysTeacherTeacher x studentdeepthroatdildoPunishmentbunny playSexual betdominatrixgroupFursuitauctionsissificationFoot fetishBisexualsex betcollarpuppyboyswitchmalesubdronefemboysFmcopFarmplaygamblingsphgimpmarriageEasterexhibitionismJennyArousalCorsetcnccheerleaderscostumesasylumsiblingsbrother sisterbrothersisteronlyfanstransmtfStraightpussyeatingMachine bondagehuman ponyLiving clotheshunterpreyunderwaterpussylionesspredator preygazelleminotaurpredator playtransformationliving suitFoxcow playfemsubponygirlsMermaidshunterVinesTentaclesexposedghostsclicheRoadPitchBrokenDownOvergrownSmartphoneFilmPathHuntedWatchedChoicesInsideLingerWalkDenseForeheadSweatGutturalSnarlSnarlingFightOrFlightInstinctHeelsShoesRemoveKnockAnnouncementWroughtIronKnockerWhipWoodenManicuredWellCampFIreLingeringScentSmellAbandonedAshVisionGlassesCaseGrinnedsex fightingfacesittinghumiationgroup sexConsequencescat fightpig playkittenlosingcoersiontransexualshemale on malehumiliaionaddictionFilming pornmf wrestlingsex fightsButchandrogynousgender fluidring gagelectrical playlostmachine sexbullyfucking machinesfucking machineChasepredictament bondageinterregationFmmmmmgangbangTrigger warningkinkcompetitionpetbondage escapelatex bondageNursedollificationFurriesanimal playbull playCheerleaderReader participationpokeranalrope bondagestreakingcontestpussy eatingcunnilingusprrdatorpreytagfurniture playhuman furniturehoodpetboybetsgamesgas maskkitten playfoot playtwo subsCatgirlPuppyabduction playfivesomefutaswitchcrossdresssissydomsissiesstrangerbettingmilkingmmffurrywifehusbandface sittingreindeer playsybianbunnybirthdayChastity cagewatersportsPolicePonyplayFemboy hootershootersself bondagedommetraoMichelsonMacbookAgedBatteredTashasTempsOnlineSearchGoggleSultryVoiceTempPhoneCallNubileYouthfulSlutFormBodyEagerFingeringCropTravelShopAdultJetMannequinClothesHungWallsMissBiancaMistressLustThighHighBootsArtfullyTastefullyHeavyQuiverBoutiqueDarkenedSeedyDiveKellys debtKellys dream adventuredomballgagchaincuffsstep-sisterdominationpantiesRosalady in redownerfacilityrubber suitsgaggedcagesobediencefearadventurecaptivitykidnaptssadismcarnivalfuta x femboychurchorgygangbrother x brotherchsstityinsestfemboy lhandjobcamshowvoyarismmother daughterchick with a dickcamgirlstreamingmother x sissycatfightAss kissingsmotherKinkysurprisenerdmusclesMakimaPowerChainsaw ManResident EvilCrossdressedcougarmilfcfnmtransdomfeet worshipchampingfemale domgothfffmfembomrubber dollfemboy on FemboyhucowPrisonImprisonmentTransman
Back to story

Chapters tagged mixed wrestling

Tagged branches inside Bdsm adventures.

Search this tag site-wide

Tagged chapters

Explore the chapters in this story that use the selected tag.

  1. The suburbs

    by Coy-toy

    Chapter 4

    Your phones GPS leads you out of the city and north, to an area of town known as the Domain. It’s one of the wealthiest suburbs of the city, with numerous large homes and mansions climbing up and down the sprawling rolling hills. The Domain also has the reputation as the new mone...

    6 years ago 804 Words 10 Likes 10,256 Views
    Bdsm mixed wrestling femdom bondage Rope
  2. Play with the kitty

    by Coy-toy

    Chapter 11

    After hearing your options, the kitty sounded like the most normal opponent you would have a chance against. You ask Penny if you can have a go at her, to which she responds “of course! Here, we have her profile loaded, take a look while I go let her know.” Penny hands you a tab...

    4 years ago 239 Words 21 Likes 4,308 Views
    Wrestling bdsm mixed wrestling
  3. Let’s you both say something.

    by Coy-toy

    Chapter 13

    “Welcome perverts, to the sexiest showdown on the web! You know how it goes, two combatants enter, trying to fuck up the loser. First to cum loses and submits to the winner, along with whatever else they agree to. We have a very special match for you tonight. First, we have a red...

    2 years ago 185 Words 15 Likes 1,955 Views
    Wrestling mixed wrestling sexfight wager femdom
  4. Go through boot camp with the Drill Sergeant

    by Coy-toy

    Chapter 11

    After hearing your options, the sergeant sounded like the best fighter to gauge your skills against. You ask Penny if you can have a go at her, to which she responds “of course! Here, we have her profile loaded, take a look while I go let her know.” Penny hands you a tablet with...

    4 years ago 256 Words 15 Likes 3,080 Views
    Wrestling bdsm toys mixed wrestling

CHYOA is a community library for interactive adult fiction, where readers choose the path and authors keep the branches growing.

  • CHYOA Guide
  • CHYOA Forum
  • Supporters
  • DMCA
  • Take It Down
  • Contact

No part may be reproduced in any form without explicit written permission. All characters in all stories on this site are over 18.

Adult stories ahead

CHYOA is a community library for interactive adult fiction. Please confirm that you are at least 18 years old and allowed to view adult content where you live.