• Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
    • Sign Up
    • Log In
  • Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
Write Sign Up Log In

Story tags

Filter the chapter branches in this story.

bdsmFemdomsissybondageChastitygaylesbianLatextrapCollegefemboyHumiliationsexfightPuppy playFfmfutatruth or darewrestlingcrossdressermale subHorrorpredatorpreyrubberFutanariBlowjobHuntPet playCrossdressingfetishfeminizationwagershemalebetpony playpublichypnosisBrotherspegginglezdomescape roomLocktobercuckhighschoolMaledomStraponpup playServantOfLilithftmofficeFutadompublic humiliationgagLost betFemalesisterleathermaidPredatororgasm denialtwinsGloryholedareMedicalMermaidPreyFox playedgingmind controlhypnotismSexual wagerbitwinktrapdomchristmasBrothertrapxtrapPrimalpetplayfarm playBethanfetish wearsex fight69mixed wrestlingdickgirlRiddleGame nightcosplaythreesomeTeenpuppyplaysororityhigh schoolSistersT4TLiving latexBad endingRole reversalSupernaturalsuccubusDeRoeForestCarDungeonGenderfluidpredicament bondageSpankingSmotheringsexual betsGamePunkJobAmnesiahaunted housefemale subzoomachinelesdombunny boyfox huntmachine playMachine fuckingmazeschooldemonBlackDoorMansionFoliageSensesnuntrap x trapRopeshemale x maletoysTeacherTeacher x studentdeepthroatdildoPunishmentbunny playSexual betdominatrixgroupFursuitauctionsissificationFoot fetishBisexualsex betcollarpuppyboyswitchmalesubdronefemboysFmcopFarmplaygamblingsphgimpmarriageEasterexhibitionismJennyArousalCorsetcnccheerleaderscostumesasylumsiblingsbrother sisterbrothersisteronlyfanstransmtfStraightpussyeatingMachine bondagehuman ponyLiving clotheshunterpreyunderwaterpussylionesspredator preygazelleminotaurpredator playtransformationliving suitFoxcow playfemsubponygirlsMermaidshunterVinesTentaclesexposedghostsclicheRoadPitchBrokenDownOvergrownSmartphoneFilmPathHuntedWatchedChoicesInsideLingerWalkDenseForeheadSweatGutturalSnarlSnarlingFightOrFlightInstinctHeelsShoesRemoveKnockAnnouncementWroughtIronKnockerWhipWoodenManicuredWellCampFIreLingeringScentSmellAbandonedAshVisionGlassesCaseGrinnedsex fightingfacesittinghumiationgroup sexConsequencescat fightpig playkittenlosingcoersiontransexualshemale on malehumiliaionaddictionFilming pornmf wrestlingsex fightsButchandrogynousgender fluidring gagelectrical playlostmachine sexbullyfucking machinesfucking machineChasepredictament bondageinterregationFmmmmmgangbangTrigger warningkinkcompetitionpetbondage escapelatex bondageNursedollificationFurriesanimal playbull playCheerleaderReader participationpokeranalrope bondagestreakingcontestpussy eatingcunnilingusprrdatorpreytagfurniture playhuman furniturehoodpetboybetsgamesgas maskkitten playfoot playtwo subsCatgirlPuppyabduction playfivesomefutaswitchcrossdresssissydomsissiesstrangerbettingmilkingmmffurrywifehusbandface sittingreindeer playsybianbunnybirthdayChastity cagewatersportsPolicePonyplayFemboy hootershootersself bondagedommetraoMichelsonMacbookAgedBatteredTashasTempsOnlineSearchGoggleSultryVoiceTempPhoneCallNubileYouthfulSlutFormBodyEagerFingeringCropTravelShopAdultJetMannequinClothesHungWallsMissBiancaMistressLustThighHighBootsArtfullyTastefullyHeavyQuiverBoutiqueDarkenedSeedyDiveKellys debtKellys dream adventuredomballgagchaincuffsstep-sisterdominationpantiesRosalady in redownerfacilityrubber suitsgaggedcagesobediencefearadventurecaptivitykidnaptssadismcarnivalfuta x femboychurchorgygangbrother x brotherchsstityinsestfemboy lhandjobcamshowvoyarismmother daughterchick with a dickcamgirlstreamingmother x sissycatfightAss kissingsmotherKinkysurprisenerdmusclesMakimaPowerChainsaw ManResident EvilCrossdressedcougarmilfcfnmtransdomfeet worshipchampingfemale domgothfffmfembomrubber dollfemboy on FemboyhucowPrisonImprisonmentTransman
Back to story

Chapters tagged femdom

Tagged branches inside Bdsm adventures.

Search this tag site-wide

Tagged chapters

Explore the chapters in this story that use the selected tag.

  1. Any advantage is good

    by Coy-toy

    Chapter 7

    “I knew I had you pegged as a good slut” She laughs. “Now on your knees slut and get to work!” With a blush you obey, getting on your knees and burying your head under her skirt into her exposed pussy. You start to lick and nibble, obeying her instructions as where and when to g...

    8 years ago 160 Words 20 Likes 10,793 Views
    Trap femdom
  2. Latex school girl

    by Coy-toy

    Chapter 8

    After applying a decent amount of makeup and styling your hair, the gurls pull out a skimpy latex schoolgirl outfit. With a poofy white collared blouse, a black tie, knee high white socks, white panties, and a black skirt that is so short it looks more like a belt, the entire ens...

    7 years ago 190 Words 17 Likes 9,708 Views
    Crossdressing Femdom latex trap sissy
  3. Mistress Kara

    by Coy-toy

    Chapter 4

    The woman standing before you is, in a word, impressive. Tall, with wide muscular shoulders that nearly fill the doorway, wide hips that flare out from her extremely tightly corseted waist, and extremely thick thighs. “Hello sweetie” She says which draws your eyes away from her b...

    7 years ago 348 Words 11 Likes 8,280 Views
    Femdom sexfight trap
  4. Bree loves it

    by gothamalleyviper

    Chapter 10

    Jen leaned back as Bree took off the thigh mounted dildo harness. Bree strutted over with a grin on her face looking at the strap-on dildo sticking up from Jen’s lap. “Found a friend for me Girlfriend?” Bree asked. Jen didn’t say anything but just smiled back as Bree crawled up...

    8 years ago 623 Words 16 Likes 5,133 Views
    Lesbian femdom bondage puppy play fetish latex
  5. The suburbs

    by Coy-toy

    Chapter 4

    Your phones GPS leads you out of the city and north, to an area of town known as the Domain. It’s one of the wealthiest suburbs of the city, with numerous large homes and mansions climbing up and down the sprawling rolling hills. The Domain also has the reputation as the new mone...

    6 years ago 804 Words 10 Likes 10,234 Views
    Bdsm mixed wrestling femdom bondage Rope
  6. Not necessary

    by Coy-toy

    Chapter 9

    “Oh I don’t need to threaten, because no matter what he’ll get what’s coming to him soon.” The tiny punk mocks. You step up to her, both standing in the middle of the mat, trying to stay unintimidated. It helps you are looking down about 8 inches at the fierce napolianic woman....

    6 years ago 115 Words 10 Likes 6,675 Views
    Sexfight bdsm femdom
  7. For some reason you think of your college mascot

    by Coy-toy

    Chapter 8

    All the names that come to mind sound either stupid or likely taken. After a few seconds of simply staring at Penny with a vacant expression, she coughs “um... so... the nickname you want is....” Unsure, you just blurt out a random one “I’ll go with the tiger!” You realize this...

    6 years ago 819 Words 9 Likes 5,032 Views
    Sexfight bdsm femdom shemale shemale on male
  8. You blurt out your college team

    by Coy-toy

    Chapter 8

    All the names that come to mind sound either stupid or likely taken. After a few seconds of simply staring at Penny with a vacant expression, she coughs “um... so... the nickname you want is....” Unsure, you just blurt out a random one “I’ll go with the tiger!” You realize this...

    6 years ago 823 Words 15 Likes 8,240 Views
    Sexfight shemale bdsm shemale x male femdom
  9. You are merely a plaything to her

    by Coy-toy

    Chapter 9

    As soon as you hear go, your reflexes kick in and you dive at the Tigress without a plan. The woman chuckles as she redirects you with a single grab, turning you around and putting you in a behind hold with one arm while the other roams your chest. Your hands grasp at the...

    6 years ago 280 Words 19 Likes 8,719 Views
    Sexfight bdsm femdom shemale humiliation
  10. She gives alittle freedom just to take it away

    by Coy-toy

    Chapter 10

    You gulp at the thought of what she could mean by her threat, but don’t have to wait long to find out. She gives your cock one more big squeeze before pushing you out of her grip. The Tigress orders “Now try as much as you like, and I’ll show you just how worthless your struggles...

    6 years ago 643 Words 23 Likes 7,798 Views
    Sexfight bdsm femdom shemale edging
  11. You couldn’t stop it even if you wanted

    by Coy-toy

    Chapter 11

    You wriggle and writhe under the grasp of the powerful woman. Despite this, all you manage to do is tire yourself out even further. All your air is restricted, only coming through the large groin of the Tigress. Your tormentor lets you struggle until you run out of energy, then...

    6 years ago 323 Words 23 Likes 7,717 Views
    Bdsm femdom shemale sexfight edging Humiliation
  12. Prove her right

    by Coy-toy

    Chapter 12

    You don’t contemplate any of the implications or consequences of what you are about to do, you simply follow the needs of your body as you crawl over to the muscular masked woman and her waiting cock. She leans back to give you access as you crawl over her massive member and begi...

    6 years ago 602 Words 28 Likes 8,142 Views
    Bdsm shemale humiliaion femdom wrestling
  13. Take a blind risk

    by Coy-toy

    Chapter 9

    Honestly you couldn’t pick which would be the worst or best case scenario between the sites, but a chance of some extra cash was why you were sitting here to begin with. Figuring it wouldn’t matter as long as you won, you went and checked off each site as a possible wager. After...

    5 years ago 168 Words 16 Likes 6,156 Views
    Wrestling femdom mf wrestling shemale bondage bdsm
  14. Pup gear

    by Coy-toy

    Chapter 10

    The ‘wrestling’ attire Penny chose for you looked more in place at a fetish club than a mat. Starting off with a leather chest harness and a tight speedo, it was nothing compared to the hood. It was a full neoprene puppy hood, black and brown, with a built in locking collar. “He...

    4 years ago 310 Words 24 Likes 5,426 Views
    Wrestling Femdom Futa Bdsm Puppy play
  15. Loser does a round on every channel

    by Coy-toy

    Chapter 12

    “She seems so confident in her training, that she’s willing to do an ultimate challenge. Loser submits to not one, but a session for every channel possible. Winner gets to pick the order and participate in any they want as well. It’s a really bold wager… especially for such a new...

    2 years ago 391 Words 13 Likes 2,013 Views
    Wrestling bdsm femdom
  16. Let’s you both say something.

    by Coy-toy

    Chapter 13

    “Welcome perverts, to the sexiest showdown on the web! You know how it goes, two combatants enter, trying to fuck up the loser. First to cum loses and submits to the winner, along with whatever else they agree to. We have a very special match for you tonight. First, we have a red...

    2 years ago 185 Words 15 Likes 1,937 Views
    Wrestling mixed wrestling sexfight wager femdom
  17. Tap for extra baggage

    by Coy-toy

    Chapter 15

    Your spine bends, between that and the dick slaps it’s too much. You don’t care about the consequences, you tap out. “Tap! Break it off!” The ref yells, and yellow kitty dumps you onto the floor, standing and stepping on you as she walks to her side. The ref continues “as you al...

    2 years ago 142 Words 17 Likes 1,951 Views
    Femdom wrestling bdsm
  18. Chastity cage

    by Coy-toy

    Chapter 16

    To your surprise, she picks up a small pink chastity cage. “This looks about the right size…” she says to the camera before turning to you. “ you know, I could choose to bind or blind you. And if you were a threat at all I would to guarantee a win. But you are so pathetic, I don’...

    2 years ago 219 Words 22 Likes 2,065 Views
    Femdom
  19. Your cock gets the cage

    by Coy-toy

    Chapter 17

    “I don’t care if the chances are low. If there is a chance, I’m gonna keep going. Plus, there is no way you could make me cum if I’m wearing that.” You know you might live to regret your words, but you couldn’t stand suffering your fate if you just surrendered to it. Knowing it...

    2 years ago 173 Words 21 Likes 2,201 Views
    Femdom chastity
  20. Still no chance

    by Coy-toy

    Chapter 18

    You are caught off guard by the match beginning, still touching your new locked jewelry. You weren’t fully turned to your competitor, so she was able to sweep you from behind this time. One again you were on the ground, this Tim face down ass up with your wrist grabbed and pulled...

    2 years ago 172 Words 16 Likes 1,950 Views
    Femdom wrestling bdsm male sub
Previous Page 2 Next

CHYOA is a community library for interactive adult fiction, where readers choose the path and authors keep the branches growing.

  • CHYOA Guide
  • CHYOA Forum
  • Supporters
  • DMCA
  • Take It Down
  • Contact

No part may be reproduced in any form without explicit written permission. All characters in all stories on this site are over 18.

Adult stories ahead

CHYOA is a community library for interactive adult fiction. Please confirm that you are at least 18 years old and allowed to view adult content where you live.