• Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Large worlds with many branches
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
  • Random Story Jump into something unexpected
  • Story of the Week A highlighted community read
  • CHYOA Forum Discuss stories with the community
  • Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Large worlds with many branches
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
  • Random Story Jump into something unexpected
  • Story of the Week A highlighted community read
  • CHYOA Forum Discuss stories with the community
  • Sign Up Save stories and write chapters
  • Log In Return to your reading shelf
Write Sign Up Log In

Story tags

Filter the chapter branches in this story.

bdsmFemdomsissybondageChastitygaylesbianLatextrapCollegefemboyHumiliationsexfightPuppy playFfmfutatruth or darewrestlingcrossdressermale subHorrorpredatorpreyrubberFutanariBlowjobHuntPet playCrossdressingfetishfeminizationwagershemalebetpony playpublichypnosisBrotherspegginglezdomescape roomLocktobercuckhighschoolMaledomStraponpup playServantOfLilithftmofficeFutadompublic humiliationgagLost betFemalesisterleathermaidPredatororgasm denialtwinsGloryholedareMedicalMermaidPreyFox playedgingmind controlhypnotismSexual wagerbitwinktrapdomchristmasBrothertrapxtrapPrimalpetplayfarm playBethanfetish wearsex fight69mixed wrestlingdickgirlRiddleGame nightcosplaythreesomeTeenpuppyplaysororityhigh schoolSistersT4TLiving latexBad endingRole reversalSupernaturalsuccubusDeRoeForestCarDungeonGenderfluidpredicament bondageSpankingSmotheringsexual betsGamePunkJobAmnesiahaunted housefemale subzoomachinelesdombunny boyfox huntmachine playMachine fuckingmazeschooldemonBlackDoorMansionFoliageSensesnuntrap x trapRopeshemale x maletoysTeacherTeacher x studentdeepthroatdildoPunishmentbunny playSexual betdominatrixgroupFursuitauctionsissificationFoot fetishBisexualsex betcollarpuppyboyswitchmalesubdronefemboysFmcopFarmplaygamblingsphgimpmarriageEasterexhibitionismJennyArousalCorsetcnccheerleaderscostumesasylumsiblingsbrother sisterbrothersisteronlyfanstransmtfStraightpussyeatingMachine bondagehuman ponyLiving clotheshunterpreyunderwaterpussylionesspredator preygazelleminotaurpredator playtransformationliving suitFoxcow playfemsubponygirlsMermaidshunterVinesTentaclesexposedghostsclicheRoadPitchBrokenDownOvergrownSmartphoneFilmPathHuntedWatchedChoicesInsideLingerWalkDenseForeheadSweatGutturalSnarlSnarlingFightOrFlightInstinctHeelsShoesRemoveKnockAnnouncementWroughtIronKnockerWhipWoodenManicuredWellCampFIreLingeringScentSmellAbandonedAshVisionGlassesCaseGrinnedsex fightingfacesittinghumiationgroup sexConsequencescat fightpig playkittenlosingcoersiontransexualshemale on malehumiliaionaddictionFilming pornmf wrestlingsex fightsButchandrogynousgender fluidring gagelectrical playlostmachine sexbullyfucking machinesfucking machineChasepredictament bondageinterregationFmmmmmgangbangTrigger warningkinkcompetitionpetbondage escapelatex bondageNursedollificationFurriesanimal playbull playCheerleaderReader participationpokeranalrope bondagestreakingcontestpussy eatingcunnilingusprrdatorpreytagfurniture playhuman furniturehoodpetboybetsgamesgas maskkitten playfoot playtwo subsCatgirlPuppyabduction playfivesomefutaswitchcrossdresssissydomsissiesstrangerbettingmilkingmmffurrywifehusbandface sittingreindeer playsybianbunnybirthdayChastity cagewatersportsPolicePonyplayFemboy hootershootersself bondagedommetraoMichelsonMacbookAgedBatteredTashasTempsOnlineSearchGoggleSultryVoiceTempPhoneCallNubileYouthfulSlutFormBodyEagerFingeringCropTravelShopAdultJetMannequinClothesHungWallsMissBiancaMistressLustThighHighBootsArtfullyTastefullyHeavyQuiverBoutiqueDarkenedSeedyDiveKellys debtKellys dream adventuredomballgagchaincuffsstep-sisterdominationpantiesRosalady in redownerfacilityrubber suitsgaggedcagesobediencefearadventurecaptivitykidnaptssadismcarnivalfuta x femboychurchorgygangbrother x brotherchsstityinsestfemboy lhandjobcamshowvoyarismmother daughterchick with a dickcamgirlstreamingmother x sissycatfightAss kissingsmotherKinkysurprisenerdmusclesMakimaPowerChainsaw ManResident EvilCrossdressedcougarmilfcfnmtransdomfeet worshipchampingfemale domgothfffmfembomrubber dollfemboy on FemboyhucowPrisonImprisonmentTransman
Back to story

Chapters tagged rope

Tagged branches inside Bdsm adventures.

Search this tag site-wide

Tagged chapters

Explore the chapters in this story that use the selected tag.

  1. The suburbs

    by Coy-toy

    Chapter 4

    Your phones GPS leads you out of the city and north, to an area of town known as the Domain. It’s one of the wealthiest suburbs of the city, with numerous large homes and mansions climbing up and down the sprawling rolling hills. The Domain also has the reputation as the new mone...

    6 years ago 10 Likes 10,195 Views
    Bdsm mixed wrestling femdom bondage Rope
  2. An attack

    by Coy-toy

    Chapter 6

    As soon as you enter the door, two large men jump you from either side. You thought you were a pretty large guy, but these men make you look closer to a mathlete. Each of them were built like pro linebackers, standing about 6’8 and full muscle under their leather jackets and crot...

    6 years ago 9 Likes 6,899 Views
    bondage rope Gay

CHYOA is a community library for interactive adult fiction, where readers choose the path and authors keep the branches growing.

  • CHYOA Guide
  • CHYOA Forum
  • Supporters
  • DMCA
  • Take It Down
  • Contact

No part may be reproduced in any form without explicit written permission. All characters in all stories on this site are over 18.

Restricted to Adults

Adult stories ahead

CHYOA is a community library for interactive adult fiction. Please confirm that you are at least 18 years old and allowed to view adult content where you live.