• Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
    • Sign Up
    • Log In
  • Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
Write Sign Up Log In

Story tags

Filter the chapter branches in this story.

bdsmFemdomsissybondageChastitygaylesbianLatextrapCollegefemboyHumiliationsexfightPuppy playFfmfutatruth or darewrestlingcrossdressermale subHorrorpredatorpreyrubberFutanariBlowjobHuntPet playCrossdressingfetishfeminizationwagershemalebetpony playpublichypnosisBrotherspegginglezdomescape roomLocktobercuckhighschoolMaledomStraponpup playServantOfLilithftmofficeFutadompublic humiliationgagLost betFemalesisterleathermaidPredatororgasm denialtwinsGloryholedareMedicalMermaidPreyFox playedgingmind controlhypnotismSexual wagerbitwinktrapdomchristmasBrothertrapxtrapPrimalpetplayfarm playBethanfetish wearsex fight69mixed wrestlingdickgirlRiddleGame nightcosplaythreesomeTeenpuppyplaysororityhigh schoolSistersT4TLiving latexBad endingRole reversalSupernaturalsuccubusDeRoeForestCarDungeonGenderfluidpredicament bondageSpankingSmotheringsexual betsGamePunkJobAmnesiahaunted housefemale subzoomachinelesdombunny boyfox huntmachine playMachine fuckingmazeschooldemonBlackDoorMansionFoliageSensesnuntrap x trapRopeshemale x maletoysTeacherTeacher x studentdeepthroatdildoPunishmentbunny playSexual betdominatrixgroupFursuitauctionsissificationFoot fetishBisexualsex betcollarpuppyboyswitchmalesubdronefemboysFmcopFarmplaygamblingsphgimpmarriageEasterexhibitionismJennyArousalCorsetcnccheerleaderscostumesasylumsiblingsbrother sisterbrothersisteronlyfanstransmtfStraightpussyeatingMachine bondagehuman ponyLiving clotheshunterpreyunderwaterpussylionesspredator preygazelleminotaurpredator playtransformationliving suitFoxcow playfemsubponygirlsMermaidshunterVinesTentaclesexposedghostsclicheRoadPitchBrokenDownOvergrownSmartphoneFilmPathHuntedWatchedChoicesInsideLingerWalkDenseForeheadSweatGutturalSnarlSnarlingFightOrFlightInstinctHeelsShoesRemoveKnockAnnouncementWroughtIronKnockerWhipWoodenManicuredWellCampFIreLingeringScentSmellAbandonedAshVisionGlassesCaseGrinnedsex fightingfacesittinghumiationgroup sexConsequencescat fightpig playkittenlosingcoersiontransexualshemale on malehumiliaionaddictionFilming pornmf wrestlingsex fightsButchandrogynousgender fluidring gagelectrical playlostmachine sexbullyfucking machinesfucking machineChasepredictament bondageinterregationFmmmmmgangbangTrigger warningkinkcompetitionpetbondage escapelatex bondageNursedollificationFurriesanimal playbull playCheerleaderReader participationpokeranalrope bondagestreakingcontestpussy eatingcunnilingusprrdatorpreytagfurniture playhuman furniturehoodpetboybetsgamesgas maskkitten playfoot playtwo subsCatgirlPuppyabduction playfivesomefutaswitchcrossdresssissydomsissiesstrangerbettingmilkingmmffurrywifehusbandface sittingreindeer playsybianbunnybirthdayChastity cagewatersportsPolicePonyplayFemboy hootershootersself bondagedommetraoMichelsonMacbookAgedBatteredTashasTempsOnlineSearchGoggleSultryVoiceTempPhoneCallNubileYouthfulSlutFormBodyEagerFingeringCropTravelShopAdultJetMannequinClothesHungWallsMissBiancaMistressLustThighHighBootsArtfullyTastefullyHeavyQuiverBoutiqueDarkenedSeedyDiveKellys debtKellys dream adventuredomballgagchaincuffsstep-sisterdominationpantiesRosalady in redownerfacilityrubber suitsgaggedcagesobediencefearadventurecaptivitykidnaptssadismcarnivalfuta x femboychurchorgygangbrother x brotherchsstityinsestfemboy lhandjobcamshowvoyarismmother daughterchick with a dickcamgirlstreamingmother x sissycatfightAss kissingsmotherKinkysurprisenerdmusclesMakimaPowerChainsaw ManResident EvilCrossdressedcougarmilfcfnmtransdomfeet worshipchampingfemale domgothfffmfembomrubber dollfemboy on FemboyhucowPrisonImprisonmentTransman
Back to story

Chapters tagged bondage

Tagged branches inside Bdsm adventures.

Search this tag site-wide

Tagged chapters

Explore the chapters in this story that use the selected tag.

  1. Humiliation and Sex are always good.

    by kaledivh

    Chapter 14

    You smile as you walk over to your new who can only moan and hump your girls as they use her as a sex toy. You spank Lisa as she thrusts, causing her to moan and look at you with lust filled eyes, not wanting to stop. You turn to regard your first as she has the same...

    7 years ago 1,907 Words 24 Likes 5,162 Views
    Lesbian sex fight bondage humiation group sex bdsm pegging
  2. Now is your chance to cum

    by Coy-toy

    Chapter 14

    “Awwww the pig. How do you like your new name?” She is still too far gone in aftershock from her orgasm, your little slut is still grinding on your boot toe, either oblivious to her loss or not caring. Figuring you only get fifteen minutes of the bonus round with your prize, you...

    7 years ago 448 Words 23 Likes 6,502 Views
    Sexfight humiliation lesbian femdom bondage
  3. Like a veteran trainer

    by Coy-toy

    Chapter 19

    The Trainer examines the fallen opponent before her, noting that the fact she was to a knee in such a one sided manor had taken a serious toll on the fierce Panther’s pride, it was not extinguished. Noting this, she anticipated the final attack as the Panther used her rema...

    7 years ago 711 Words 28 Likes 5,625 Views
    Sexfight pet play bondage femdom lesbian lezdom humiliation orgasm denial
  4. You feel lucky

    by Coy-toy

    Chapter 11

    Looking up from your tumble, you see not only are you practically on top of the Punk, your rope is still nearby. Thinking quick, you climb straddling her belly and take the lasso, wraping it around her left hand. She starts to realize her position, and attempts to push you off. T...

    7 years ago 88 Words 13 Likes 4,319 Views
    Bondage
  5. You must be a natural

    by Coy-toy

    Chapter 12

    “What the fuck!” The punk yells out, trying to pull her wrists apart. You knot holds though, and gives you time to look around at what else you could grab. You smile as you see a perfect item to help put this match away, and reach to grab it. Now holding a tight black latex hood,...

    7 years ago 154 Words 18 Likes 4,010 Views
    Sexfight lesbian bondage
  6. Getting to know Vixen

    by gothamalleyviper

    Chapter 8

    Jen came to in a strange room in a panic. “Relax,” Kelly said leaning down towards Jen, “The match is over, you are back stage.” “Oh thank god,” Jen’s eyes fluttered, “Vixen just humiliated me.” “Nothing personal honey,” Vixen’s voice came from Jen’s left ear. Jen’s eyes went...

    8 years ago 552 Words 17 Likes 5,885 Views
    Latex bondage lesbian fetish
  7. Why not? It's not like you can brainwash someone to be a lesbian, right?

    by gothamalleyviper

    Chapter 9

    “Sure,” Jen said, “It’s not like I am going anywhere.” Jen noticed the shit eating grin on Kelly’s face as she went and grabbed a VR headset. Jen took a deep breath before Kelly put the headset on and started the video program. It started showing images of girls, soon Jen notice...

    8 years ago 478 Words 19 Likes 5,520 Views
    Latex bondage fetish lesbian mind control
  8. Bree loves it

    by gothamalleyviper

    Chapter 10

    Jen leaned back as Bree took off the thigh mounted dildo harness. Bree strutted over with a grin on her face looking at the strap-on dildo sticking up from Jen’s lap. “Found a friend for me Girlfriend?” Bree asked. Jen didn’t say anything but just smiled back as Bree crawled up...

    8 years ago 623 Words 16 Likes 5,133 Views
    Lesbian femdom bondage puppy play fetish latex
  9. The suburbs

    by Coy-toy

    Chapter 4

    Your phones GPS leads you out of the city and north, to an area of town known as the Domain. It’s one of the wealthiest suburbs of the city, with numerous large homes and mansions climbing up and down the sprawling rolling hills. The Domain also has the reputation as the new mone...

    6 years ago 804 Words 10 Likes 10,234 Views
    Bdsm mixed wrestling femdom bondage Rope
  10. Take a blind risk

    by Coy-toy

    Chapter 9

    Honestly you couldn’t pick which would be the worst or best case scenario between the sites, but a chance of some extra cash was why you were sitting here to begin with. Figuring it wouldn’t matter as long as you won, you went and checked off each site as a possible wager. After...

    5 years ago 168 Words 16 Likes 6,156 Views
    Wrestling femdom mf wrestling shemale bondage bdsm
  11. You haven’t earned it

    by Coy-toy

    Chapter 12

    Your heart crashes as his hand suddenly withdraws, leaving you helplessly humping the air and wailing “no no no no!” beneath him. Lubin mercilessly laughs and slaps your face, quieting you as he firmly grasps over your mouth and looks deep into you. “Quiet down slut. You need to...

    6 years ago 193 Words 27 Likes 5,919 Views
    Pegging strapon genderfluid trap bdsm bondage blowjob
  12. The playrooms

    by Coy-toy

    Chapter 6

    Heading over to the playrooms, it is amazing how authentic and diverse the individual setups are. You cant help but watch the jail room scene for a bit, where the imprisoned girl is giving an amazing blowjob through the cell bars and turning you on greatly. The girl was completel...

    6 years ago 190 Words 18 Likes 20,169 Views
    Bdsm bondage maledom
  13. Heavy bondage

    by Coy-toy

    Chapter 9

    “I think I know... keep your cute ass right there!” She says as she delivers a particularly sharp slap to your ass. You squeal at the sudden pain, muttering a “yes ma’am” She gets a large amount of gear from a nearby shelf and descends upon you. First she adds leather cuffs to y...

    7 years ago 158 Words 35 Likes 15,929 Views
    Bondage femdom Trap Teacher x student
  14. Put your mouth to good use

    by Coy-toy

    Chapter 11

    “Well I think it’s time to show what a good teachers pet you can be.” She walks around you, hand gliding over your twitching body, until she is right in front of your face. She slowly removes her white latex panties, and puts them on the desk next to you. She then lifts a leg, p...

    6 years ago 303 Words 37 Likes 13,774 Views
    Femdom Crossdresser trap bondage Bdsm
  15. To be left bound and exposed

    by Coy-toy

    Chapter 12

    She turns to grab something, and she turn back with something in her hands. Before you can react she shoves a large metal ring gag in your pussy soaked mouth, locking the attaching harness behind your head. “Now now... see I know the biggest reward to a slut like you is something...

    7 years ago 204 Words 40 Likes 12,614 Views
    Bondage ring gag Femdom crossdresser bdsm Public
  16. Another trap

    by Coy-toy

    Chapter 13

    Bound as you are, facing the chalkboard with the dungeon behind you, you have no idea what else is happening in the dungeon or who can see your oh so state. After what you went through though, you hardly care. All you can think of is how amazingly horny you are, drippi...

    7 years ago 524 Words 40 Likes 10,637 Views
    Bdsm trapxtrap crossdresser bondage
  17. Someone joins in

    by Coy-toy

    Chapter 14

    You are lost in your first face fucking, almost forgetting the fact that you are bound over the school desk with your hooked ass and dangling cock open to the club. The schoolgirl trap fucking your face, you realize you don’t even know their name, has their skirt over your head a...

    7 years ago 103 Words 25 Likes 7,460 Views
    Trapxtrap bdsm crossdresser Bondage
  18. Get your first taste of cum

    by Coy-toy

    Chapter 14

    You are lost in your first face fucking, almost forgetting the fact that you are bound over the school desk with your hooked ass and dangling cock open to the club. The schoolgirl trap fucking your face, you realize you don’t even know their name, has their skirt over your head a...

    7 years ago 278 Words 45 Likes 9,347 Views
    Bondage bdsm crossdresser trapxtrap
  19. Principal Augustine

    by Sparkee23

    Chapter 16

    The tight fishnet stockings, connected by garters under an unseemly short latex skirt with her white poofy button down shirt covered at the waist by a black tight corset is unmistakable. That face covered by a black hood with white accents around the open eyes and mouth, with a s...

    5 years ago 408 Words 32 Likes 5,679 Views
    Femdom trap bondage bdsm
  20. A group with a voice you recognize

    by Coy-toy

    Chapter 13

    Bound as you are, facing the chalkboard with the dungeon behind you, you have no idea what else is happening in the dungeon or who can see your oh so state. After what you went through though, you hardly care. All you can think of is how crazily horny you are. It feels...

    7 years ago 172 Words 26 Likes 6,940 Views
    Bdsm trap bondage
Previous Page 2 Next

CHYOA is a community library for interactive adult fiction, where readers choose the path and authors keep the branches growing.

  • CHYOA Guide
  • CHYOA Forum
  • Supporters
  • DMCA
  • Take It Down
  • Contact

No part may be reproduced in any form without explicit written permission. All characters in all stories on this site are over 18.

Adult stories ahead

CHYOA is a community library for interactive adult fiction. Please confirm that you are at least 18 years old and allowed to view adult content where you live.