• Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
    • Sign Up
    • Log In
  • Trending Stories Stories gaining momentum this week
  • Recently Updated Latest chapters and branches
  • New Stories Fresh starts from authors
  • Deep Stories Stories with long published paths
  • Many Paths Stories with lots of reader choices
  • Deep & Branching Stories with long paths and many choices
  • Most Liked Stories readers liked most
  • Most Viewed Stories readers return to
  • Customizable Stories with reader variables
  • Game Mode Stories with rules and state
  • Story Categories Find stories by genre and theme
  • News Feed Public activity across CHYOA
  • Active Polls Open chapter polls across visible stories
  • Leaderboard Awarded community writers
    • Random Story
    • Story of the Week
    • CHYOA Guide
    • CHYOA Forum
Write Sign Up Log In

Story tags

Filter the chapter branches in this story.

bdsmFemdomsissybondageChastitygaylesbianLatextrapCollegefemboyHumiliationsexfightPuppy playFfmfutatruth or darewrestlingcrossdressermale subHorrorpredatorpreyrubberFutanariBlowjobHuntPet playCrossdressingfetishfeminizationwagershemalebetpony playpublichypnosisBrotherspegginglezdomescape roomLocktobercuckhighschoolMaledomStraponpup playServantOfLilithftmofficeFutadompublic humiliationgagLost betFemalesisterleathermaidPredatororgasm denialtwinsGloryholedareMedicalMermaidPreyFox playedgingmind controlhypnotismSexual wagerbitwinktrapdomchristmasBrothertrapxtrapPrimalpetplayfarm playBethanfetish wearsex fight69mixed wrestlingdickgirlRiddleGame nightcosplaythreesomeTeenpuppyplaysororityhigh schoolSistersT4TLiving latexBad endingRole reversalSupernaturalsuccubusDeRoeForestCarDungeonGenderfluidpredicament bondageSpankingSmotheringsexual betsGamePunkJobAmnesiahaunted housefemale subzoomachinelesdombunny boyfox huntmachine playMachine fuckingmazeschooldemonBlackDoorMansionFoliageSensesnuntrap x trapRopeshemale x maletoysTeacherTeacher x studentdeepthroatdildoPunishmentbunny playSexual betdominatrixgroupFursuitauctionsissificationFoot fetishBisexualsex betcollarpuppyboyswitchmalesubdronefemboysFmcopFarmplaygamblingsphgimpmarriageEasterexhibitionismJennyArousalCorsetcnccheerleaderscostumesasylumsiblingsbrother sisterbrothersisteronlyfanstransmtfStraightpussyeatingMachine bondagehuman ponyLiving clotheshunterpreyunderwaterpussylionesspredator preygazelleminotaurpredator playtransformationliving suitFoxcow playfemsubponygirlsMermaidshunterVinesTentaclesexposedghostsclicheRoadPitchBrokenDownOvergrownSmartphoneFilmPathHuntedWatchedChoicesInsideLingerWalkDenseForeheadSweatGutturalSnarlSnarlingFightOrFlightInstinctHeelsShoesRemoveKnockAnnouncementWroughtIronKnockerWhipWoodenManicuredWellCampFIreLingeringScentSmellAbandonedAshVisionGlassesCaseGrinnedsex fightingfacesittinghumiationgroup sexConsequencescat fightpig playkittenlosingcoersiontransexualshemale on malehumiliaionaddictionFilming pornmf wrestlingsex fightsButchandrogynousgender fluidring gagelectrical playlostmachine sexbullyfucking machinesfucking machineChasepredictament bondageinterregationFmmmmmgangbangTrigger warningkinkcompetitionpetbondage escapelatex bondageNursedollificationFurriesanimal playbull playCheerleaderReader participationpokeranalrope bondagestreakingcontestpussy eatingcunnilingusprrdatorpreytagfurniture playhuman furniturehoodpetboybetsgamesgas maskkitten playfoot playtwo subsCatgirlPuppyabduction playfivesomefutaswitchcrossdresssissydomsissiesstrangerbettingmilkingmmffurrywifehusbandface sittingreindeer playsybianbunnybirthdayChastity cagewatersportsPolicePonyplayFemboy hootershootersself bondagedommetraoMichelsonMacbookAgedBatteredTashasTempsOnlineSearchGoggleSultryVoiceTempPhoneCallNubileYouthfulSlutFormBodyEagerFingeringCropTravelShopAdultJetMannequinClothesHungWallsMissBiancaMistressLustThighHighBootsArtfullyTastefullyHeavyQuiverBoutiqueDarkenedSeedyDiveKellys debtKellys dream adventuredomballgagchaincuffsstep-sisterdominationpantiesRosalady in redownerfacilityrubber suitsgaggedcagesobediencefearadventurecaptivitykidnaptssadismcarnivalfuta x femboychurchorgygangbrother x brotherchsstityinsestfemboy lhandjobcamshowvoyarismmother daughterchick with a dickcamgirlstreamingmother x sissycatfightAss kissingsmotherKinkysurprisenerdmusclesMakimaPowerChainsaw ManResident EvilCrossdressedcougarmilfcfnmtransdomfeet worshipchampingfemale domgothfffmfembomrubber dollfemboy on FemboyhucowPrisonImprisonmentTransman
Back to story

Chapters tagged bdsm

Tagged branches inside Bdsm adventures.

Search this tag site-wide

Tagged chapters

Explore the chapters in this story that use the selected tag.

  1. Zach for the mixed sex league

    by Coy-toy

    Chapter 3

    The implications of the piece of paper swirl through your head as you continue to your dorm room, through the door and flop on your bed. Extra money would certainly help... hell if you got five grand you could quit your crappy part time job for the rest of the semester. You thin...

    6 years ago 273 Words 13 Likes 18,906 Views
    Bdsm sexfight college
  2. The suburbs

    by Coy-toy

    Chapter 4

    Your phones GPS leads you out of the city and north, to an area of town known as the Domain. It’s one of the wealthiest suburbs of the city, with numerous large homes and mansions climbing up and down the sprawling rolling hills. The Domain also has the reputation as the new mone...

    6 years ago 804 Words 10 Likes 10,234 Views
    Bdsm mixed wrestling femdom bondage Rope
  3. Industrial area

    by Coy-toy

    Chapter 4

    You drive along in your crappy old car as you work your way out of downtown and into the more industrial area. Old warehouses surround you, most still in use but one or two clearly abandoned with broken windows and graffiti. You must fully rely on your gps, twisting through diffe...

    6 years ago 620 Words 21 Likes 15,842 Views
    Bdsm sexfight college
  4. Three round

    by Coy-toy

    Chapter 5

    Penny looks over her glasses at you, giving off a bit of a teacher or librarian vibe as she begins. “Ok Zach, as I had mentioned, the very basics is that this is a tournament filming adults wrestling and then having sex with one another. Everything at every point is consensual, w...

    6 years ago 339 Words 16 Likes 10,333 Views
    Sexfight bdsm
  5. Don’t be last place

    by Coy-toy

    Chapter 6

    “So... I doubt it will ever affect you, but we have an official tradition. After your second fight you’ll receive your rank, and whichever male and female has the lowest ranking must train under the top fighter of the opposite gender. What this actually means is that the lowest r...

    6 years ago 121 Words 12 Likes 8,418 Views
    Sexfight bdsm
  6. Nickname

    by Coy-toy

    Chapter 7

    You think about it only for a second. Obviously putting your real name out on the Internet could always have unintentional consequences... So a nickname seems like the best idea. “I think I’ll go with a nickname, if that’s all right with you. Do I get to pick my own, or are they...

    6 years ago 318 Words 15 Likes 8,076 Views
    Sexfight bdsm
  7. The punk

    by Coy-toy

    Chapter 8

    “So this is somewhat good news for you. Your first opponent will be Shelby, also known as the Punk. She isn’t too highly ranked, only 36th out of the 48 women fighters we have. She is likely hoping to beat up on a rookie to raise her rank, but it also means she wont be quite as g...

    6 years ago 606 Words 17 Likes 8,126 Views
    Bdsm sexfight
  8. Not necessary

    by Coy-toy

    Chapter 9

    “Oh I don’t need to threaten, because no matter what he’ll get what’s coming to him soon.” The tiny punk mocks. You step up to her, both standing in the middle of the mat, trying to stay unintimidated. It helps you are looking down about 8 inches at the fierce napolianic woman....

    6 years ago 115 Words 10 Likes 6,675 Views
    Sexfight bdsm femdom
  9. Your strength barely gives you an edge

    by Coy-toy

    Chapter 10

    As you begin, the two of you slowly circle each other. You try to push her lightly, only for her to deflect you. You do the same to her probing attempt. Both of you are cautious to make the first attempt, but her experience gives her more patience, as you go in for a full power g...

    6 years ago 497 Words 12 Likes 6,144 Views
    Sexfight Bdsm
  10. She gets you to bet something permanent

    by Coy-toy

    Chapter 9

    “You know... I do have the normal wager I like to make, but after seeing my opponent I’m sure he is too much of a little chickenshit to take me up on it” the Punk mocks, staring right into your eyes. You know your being provoked, that only a fool would fall for such provocation....

    6 years ago 273 Words 15 Likes 7,669 Views
    Bdsm sexfight wager
  11. Your strength gives you a slight advantage

    by Coy-toy

    Chapter 10

    As you begin, the two of you slowly circle each other. You try to push her lightly, only for her to deflect you. You do the same to her probing attempt. Both of you are cautious to make the first attempt, but her experience gives her more patience, as you go in for a full power g...

    6 years ago 497 Words 18 Likes 6,235 Views
    Sexfight bdsm
  12. Some women are packing

    by Coy-toy

    Chapter 6

    “So... we currently have 48 women fighters, and about a dozen male fighters. Part of the reason is that we also have woman on woman matches, and the other part is, well, some of our girls are... packing, and not every guy is ok going against those that are. So before we start, wo...

    6 years ago 164 Words 10 Likes 6,239 Views
    Sexfight bdsm transexual
  13. No problem

    by Coy-toy

    Chapter 7

    You hadn’t ever thought of sleeping with shemales before. You hadn’t ever considered yourself gay or bi, and you didn’t know if having sex with a chick with a dick would be or not. You kind of mentally test yourself by looking at Penny. You considered her fairly hot, and imagined...

    6 years ago 258 Words 7 Likes 5,385 Views
    Bdsm sexfight shemale shemale x male
  14. For some reason you think of your college mascot

    by Coy-toy

    Chapter 8

    All the names that come to mind sound either stupid or likely taken. After a few seconds of simply staring at Penny with a vacant expression, she coughs “um... so... the nickname you want is....” Unsure, you just blurt out a random one “I’ll go with the tiger!” You realize this...

    6 years ago 819 Words 9 Likes 5,032 Views
    Sexfight bdsm femdom shemale shemale on male
  15. First to cum

    by Coy-toy

    Chapter 5

    Penny looks over her glasses at you, giving off a bit of a teacher or librarian vibe as she begins. “Ok Zach, as I had mentioned, the very basics is that this is a tournament filming adults wrestling and then having sex with one another. Everything at every point is consensual, w...

    6 years ago 288 Words 16 Likes 13,092 Views
    Sexfight bdsm
  16. Their is a tier rating system

    by Coy-toy

    Chapter 6

    Penny just gets into it. “So, just so you know, we do have something else that affects your rank other than your performance. The more, well, kinky you allow the after round to be, the higher ranked matches you are generally in since they pay better. In practice, this means the b...

    6 years ago 196 Words 20 Likes 8,489 Views
    Bdsm
  17. Shelby

    by everyoneKtoA

    Chapter 8

    Your first opponent will be Shelby, also known as the Punk. She isn’t too highly ranked, only 21th out of the 32 women fighters we have. She is hoping to beat up on a rookie to raise her victory count, but it also means she isn’t quite as good as most of your potential opponents....

    6 years ago 561 Words 14 Likes 7,566 Views
    Sexfight bdsm strapon shemale
  18. Hesitantly no

    by Coy-toy

    Chapter 7

    You hadn’t ever thought of sleeping with a chick with a dick before. You hadn’t ever considered yourself gay or bi, and you didn’t know if having sex with a chick with a dick would be or not. You kind of mentally test yourself by looking at Penny. You considered her fairly hot, a...

    6 years ago 267 Words 15 Likes 10,116 Views
    Futa sexfight bdsm
  19. You blurt out your college team

    by Coy-toy

    Chapter 8

    All the names that come to mind sound either stupid or likely taken. After a few seconds of simply staring at Penny with a vacant expression, she coughs “um... so... the nickname you want is....” Unsure, you just blurt out a random one “I’ll go with the tiger!” You realize this...

    6 years ago 823 Words 15 Likes 8,240 Views
    Sexfight shemale bdsm shemale x male femdom
  20. You are merely a plaything to her

    by Coy-toy

    Chapter 9

    As soon as you hear go, your reflexes kick in and you dive at the Tigress without a plan. The woman chuckles as she redirects you with a single grab, turning you around and putting you in a behind hold with one arm while the other roams your chest. Your hands grasp at the...

    6 years ago 280 Words 19 Likes 8,719 Views
    Sexfight bdsm femdom shemale humiliation
Previous Page 4 Next

CHYOA is a community library for interactive adult fiction, where readers choose the path and authors keep the branches growing.

  • CHYOA Guide
  • CHYOA Forum
  • Supporters
  • DMCA
  • Take It Down
  • Contact

No part may be reproduced in any form without explicit written permission. All characters in all stories on this site are over 18.

Adult stories ahead

CHYOA is a community library for interactive adult fiction. Please confirm that you are at least 18 years old and allowed to view adult content where you live.