Write a Story Sign Up Log In
Back to Story

Chapters tagged enm

In Women Want You Naked

  1. The skeptic becomes a believer

    The skeptic becomes a believer by dbzzzzz

    Chapter 6

    The cheers finally began to settle, leaving a heavy, electric tension hanging in the air. It wasn't the polite applause of a theater audience — it was hungry, anticipatory. Every woman in the room leaned forward in her seat, grinning, whispering, eager. Elanor spun on her heel t...

    17 Likes
    967 Views
    More cfnm, enm, oon, stage, magic
  2. Unveiled

    Unveiled by dbzzzzz

    Chapter 7

    The applause hadn’t even died down when the booing started. It wasn’t angry. It was almost playful — a chorus of disappointed, pouting sounds from hundreds of women. You froze behind the cloth panels, naked but hidden, blinking in confusion. Elanor turned, riding crop tapping...

    18 Likes
    1,013 Views
    More cfnm, enm, oon, stage, public
  3. Naked Truth

    Naked Truth by dbzzzzz

    Chapter 8

    The applause hadn’t even died down when instinct took over. You snapped your hands over your cock, shielding yourself, trembling from a hurricane of shame, humiliation — and worse, raw arousal that left you dizzy. Talia stepped closer, her voice barely above a whisper, sweet and...

    17 Likes
    924 Views
    More enm, cfnm, oon, stage, erection, exhibitionism, exhibitionist, edging
  4. Audience participation begins

    Audience participation begins by dbzzzzz

    Chapter 9

    Elanor circled you like a lioness savoring the trembling of her prey. "You know," she said, tapping her riding crop lazily against her gloved palm, "you’re even more stunning when you obey so nicely." The golden lasso still pulsed faintly around the base of your cock, tightenin...

    17 Likes
    787 Views
    More enm, cfnm, oon, public, magic, stage, edging
  5. Teased and denied

    Teased and denied by dbzzzzz

    Chapter 10

    You barely remained standing, your hands bound behind your back, your cock leaking freely into the hot, electric air. The dildo — your perfect clone — passed from woman to woman, each new set of hands igniting a fresh wave of unbearable, trembling sensation along your shaft. A...

    16 Likes
    744 Views
    More cfnm, enm, magic, stage, oon, public, edging, exhibitionism, exhibitionist
  6. Choice of exposure

    Choice of exposure by dbzzzzz

    Chapter 11

    When the crowd's hunger reached a fever pitch — moaning, chanting, screaming for you to cum — Elanor raised her hand, commanding silence like a queen. The room fell still. You stood, trembling, your cock twitching uncontrollably, shining with precum. Elanor's voice rang out:...

    20 Likes
    762 Views
    More enm, cfnm, stripped, stage, magic, nip, public, oon, edging, exhibitionist
  7. The Grand Finale!

    The Grand Finale! by dbzzzzz

    Chapter 12

    You stood trembling, utterly bare, utterly , utterly adored. The crowd's cheers still echoed in your ears, but the world narrowed — narrowed to Talia, stepping lightly off the stage, disappearing just out of the audience's sight... but not out of yours. You followed h...

    20 Likes
    944 Views
    More enm, cfnm, magic, naked, orgasm, public orgasm, naked in public, public, imposed orgasm
  8. Epilogue: Encore?

    Epilogue: Encore? by dbzzzzz

    Chapter 13

    You collapsed into bed hours later — exhausted, aching, and happier than you’d ever been. Talia lay beside you, naked and flushed, curled up against your side, trailing lazy fingers over your chest. She sighed contentedly, propping her chin on your shoulder. "You were amazing,...

    21 Likes
    734 Views
    More enm, cfnm, oon
  9. A Massage Class

    A Massage Class by dbzzzzz

    Chapter 2

    You push the door open and step into the warm haze of eucalyptus oil and low lamplight. It’s the same room you’ve been coming to for weeks now—rows of padded tables, little carts of oils and towels, the faint hum of a diffuser in the corner. But today feels different. The air has...

    9 Likes
    1,511 Views
    More enm, cfnm, oon, class, massage
  10. The girls get massaged

    The girls get massaged by dbzzzzz

    Chapter 3

    Camille’s smile has that soft steel in it again as she gathers you around the tables. “Today,” she says, braid brushing her shoulder as her eyes sweep over each of you, “is the final practicum. We’ll rotate, everyone receiving a full-body sequence. Real skin, real muscle, real t...

    12 Likes
    794 Views
    More massage, enm, cfnm
  • «
  • »

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

enmcfnmembarassed masturbationembarassed erectionorgasm at dinnerfootjobthe only one nakednaked mealHandjobfemdomnude in publicnaked for dinnernaked at a restaurantnude diningplease stay nakedoonembarrassed nudenaked first datestolentowelnudeofficestrippedexhibitionistembarrassmentpoolbig erectionerectionsembarrassing erectionpublic nude erectionnaked in front of a crowdvideorecordedtiedrestrainedunable to covercollegeseniorpublic nudityhumiliationexhibitionsitexhibitionismfirst datenaked on a dateerectionpublic erectionerect penisvisible shaftarousal in publicnaked erection in publicuncoverednaked in public on a first date with a huge bonernude dateNude MaleNude FemaleNFNMNude modellingYoure NakedTeacherHard PenisErection while modellingprecumbonerhard dickabout to cumteasingnude musemale musemodelling nakednaked malenaked in schoolnaked in classarousalhard-onnaked for teacherembarrassed maleclothed female naked maleonly one nakedassisted exposureflirty girlsexcited classmateswagerbetlost betfantasyknightexhibitionsmcolleaguenaked in publicworkplacerurallibrarianembarrassed naked malesFarmFarmerAPHAverage dickaverage penisaverage cocklost betsbetsstripstripped in schoolstripped by classmatesnaked in front of everyonemassagehigh school nudephotophotoshootclasscoedexhibtionistPre-marital hand holdingnakeddinner nakednude modelnaked for a crowdnaked in front of crushshy posingembarrassed nude malenaked at schoolnaked outdoorsnaked in front of teacherraging public bonerNude outdoorserection in publicmale orgasmorgasm in front of everyonecumming in publicnude at dinnerclothed females nude malenipnude and aroused in publichigh schoolstreakingoutdoorsnuditynaked outsidecafesex at schoolfucking a crushfucking outdoorssex in publicmale nudewet and nakedpublic arousalaccidental public nudityBottomlesssudden nudityGrocery storestageedgingpublicmagicembarrassed erectionflinging precumthrobbing bonerAsian girlslegalHRmuseillustrationanxietyGymprincesscastlelobbyhotelFondlingSpankinghigh school girlsexcited girlsshy guythreat of exposureCasual NudityHome NudismNudismNudistHome NudistNaturismNaturistTopfreedomTopfreeToplessPublic ExposurePublic BonerBouncing PenisBouncing BallsBouncing BonerPrePre-CumMale NudityMale ExhibitionistMale ExhibitionismHeight DifferenceBarefootBare FeetFlashingclothed teacher nude studentnude in classoutdoor nudetowelwaiterpose nudedrawing your nude bodyoogling girlsnude in front of groupblack girlemo girlasian girlflirty teacherhardmake-outkissingcaughtnaked at the officeflirty classRISKYCLOTHES STOLENSHARED BEDRISKY ERECTIONRISKY BONERHARD COCKRomanceDatingCoupleNaked BoyfriendEmbarrassed Naked MaleZenraExposedStrippingClothed Female Nude MaleClothed Female Nakek MaleExposureHuge BoobsBig TitsLarge BreastsBustyBuxomSouthern BelleGirlfriendwatching you undressraging bonershy nudechoose to stripstripping for classEdgedRISKY NUDITYhandcuffpictureorgasm controlteacher crushalone with teacherworkout without clothesBarefoot teacherNude exercisenude in front of teachernude in schoolclassmates touchingmale arousedthrobbingnude in front of classassisted nudeshaftmale bodyembarassed arousalnude at workphotograheroiledarrogantexhbitionistteasedcumoralblow jobsex with teachersex in schoolAccidental NudityNude posingnaked teacherlife drawinghazingrushgamehandsyphotographyuncontrolled thustingstrokingaccidental cummingorgasm in classfootfetishbachelorette partypokersupportivenaked in the sunwet pantieswet bonercrossoverpicturescmnfgrindingbreast suckingprofessorMILFBoobiehugBreath SmotherMarshmallow HellBreastplayDirty Talkmagical kingdomqueenAsianGlassesHeadpatsBack RubsPublic Sexcum competetionteacher approved nudityoutdoor nude photoshootstrip gamereality tvvoyeursex during photoshootteacher giving headpublic sex with teacheroral in publicoral in classpenis sneaks into mouthphotographedmasturbationinterng stringshowtv showreality showcheerleadersmissing clothesenfonly maleAss SqueezeBreast Grabdripping erectionmale modelnude in art classcoffeelegally nudenude in officedeliveryoffice oonbossemployeestrip pokerorgasmpublic orgasmimposed orgasmWet spotwet penisVisible erectionfilmedphotographerspeedonaked in officeHugsHuggingSnugglingCuddlesLap SittingSitting in LapMommy DomSoft DomGentle DomBBWBlondeFrecklesTHICCcockringcock ringpenis measuringpenis measuredmeasuredmeasuringpenis sizepenile lengthpenis exposurenaked at dinnerfeetexposed arousalhuge erectionaroused in publicnaked and aroused in publicideassororityedgeoffice nudityswimsuitLatinaMexicanabondagenaked in front of strangerstouchy classmatesconcealment is futileclothed females naked malenaked in a crowdencouraged nakedashameddefeated shamenude guiltnude at schoolclothing breaknude in highschoolclothes falling offdisrobeclothing falls offaccidental nudeembarassing nude drawingswitchesstrokedEx-girlfriendskinnydippingdreammeasurementerectpantsedcocknaked in front of classthrobbing penisnude for everyonechoiceSubmissivepublic nudenaked on public beachunwanted orgasmboss makes you cumstripped by bosscrowd of onlookerscum in mouthcum spraycum tornadocum blizzardgiant orgasmclimaxcum on teachercum on classmatestvfacialsunblocksunscreenstreakphotocopyexhbitioinistcosplayroleplayFlat ChestSmall TitsNerd GirlRedheadblowjobdominationmodelworkstripped in publicnaked in front of classmatesundressing in classswimwearbargainShortstackCuddlingnaked on a first daterural nudeWet DreamMorning Wood