Write a Story Sign Up Log In
Back to Story

Chapters tagged cfnm

In Women Want You Naked

  1. The Grand Finale!

    The Grand Finale! by dbzzzzz

    Chapter 12

    You stood trembling, utterly bare, utterly , utterly adored. The crowd's cheers still echoed in your ears, but the world narrowed — narrowed to Talia, stepping lightly off the stage, disappearing just out of the audience's sight... but not out of yours. You followed h...

    20 Likes
    944 Views
    More enm, cfnm, magic, naked, orgasm, public orgasm, naked in public, public, imposed orgasm
  2. Epilogue: Encore?

    Epilogue: Encore? by dbzzzzz

    Chapter 13

    You collapsed into bed hours later — exhausted, aching, and happier than you’d ever been. Talia lay beside you, naked and flushed, curled up against your side, trailing lazy fingers over your chest. She sighed contentedly, propping her chin on your shoulder. "You were amazing,...

    21 Likes
    734 Views
    More enm, cfnm, oon
  3. A Massage Class

    A Massage Class by dbzzzzz

    Chapter 2

    You push the door open and step into the warm haze of eucalyptus oil and low lamplight. It’s the same room you’ve been coming to for weeks now—rows of padded tables, little carts of oils and towels, the faint hum of a diffuser in the corner. But today feels different. The air has...

    9 Likes
    1,512 Views
    More enm, cfnm, oon, class, massage
  4. The girls get massaged

    The girls get massaged by dbzzzzz

    Chapter 3

    Camille’s smile has that soft steel in it again as she gathers you around the tables. “Today,” she says, braid brushing her shoulder as her eyes sweep over each of you, “is the final practicum. We’ll rotate, everyone receiving a full-body sequence. Real skin, real muscle, real t...

    12 Likes
    794 Views
    More massage, enm, cfnm
  5. They get to work on your back

    They get to work on your back by dbzzzzz

    Chapter 4

    “Since you’re our only man,” Camille says, braid sliding against her shoulder, “we’ll do this differently. All three of you will practice every segment on John’s back—top to bottom. Observation, correction, repeat. We’ll save the front for next.” Her eyes find you for half a hea...

    11 Likes
    697 Views
    More cfnm, oon, enm, exhibitionist, towel
  6. Your front is up next

    Your front is up next by dbzzzzz

    Chapter 5

    “Eyes forward,” Camille says, braid brushing over her shoulder as she pivots back toward you. She doesn’t have to raise her voice. They all obey. And suddenly you’re exposed—not naked, not even immodest—but lying flat on your back with nothing between your cock and their stares...

    12 Likes
    690 Views
    More cfnm, oon, enm
  7. When the cat's away....

    When the cat's away.... by dbzzzzz

    Chapter 6

    Savannah’s palms glide higher up your thigh, thumbs pressing into the dense muscle just shy of where the towel begins. Rachel mirrors her on the other side, calm and deliberate, her fingers spreading heat in long strokes up and down the inside of your leg. The two of them flank y...

    11 Likes
    670 Views
    More cfnm, enm, oon, exposed, exhibitionist
  8. Towel Work

    Towel Work by dbzzzzz

    Chapter 8

    Camille moves to the head of the table and smooths the towel with two careful passes, palm firm, the other hand anchoring at your hip. Her voice is low, precise. “Keep the towel taut so the friction translates without direct contact. You’re creating a sheath out of cloth—pressur...

    10 Likes
    560 Views
    More enm, cfnm, handjob, towel, oon
  9. Some self love

    Some self love by dbzzzzz

    Chapter 9

    “Module two,” Camille says, silk over steel. “John, begin. Go on. Show us how you touch yourself.” Your hand hovers, then closes. Heat roars up your spine at the first stroke. The room seems to tilt—three women in leggings and tanks, eyes avid, Camille at your shoulder like a me...

    9 Likes
    588 Views
    More cfnm, enm, oon, edging, exhbitionist, teased, exposed
  10. Hands on Learning

    Hands on Learning by dbzzzzz

    Chapter 10

    Camille’s eyes linger on your cock, slick and flushed, before she straightens. Her braid slides over her shoulder as she addresses the room. “Module three: manual release. This one is simple—hand-to-skin. It is up to the therapist how far she wishes to go. Some stop at stroking....

    12 Likes
    562 Views
    More cfnm, enm, oon, massage, edging
  • «
  • »

No part may be reproduced in any form without explicit written permission.
All characters in all stories on this site are over 18.

  • CHYOA Guide
  • CHYOA Forum
  • Thank You
  • DMCA
  • Take It Down
  • Contact
Restricted to Adults

Tags

enmcfnmembarassed masturbationembarassed erectionorgasm at dinnerfootjobthe only one nakednaked mealHandjobfemdomnude in publicnaked for dinnernaked at a restaurantnude diningplease stay nakedoonembarrassed nudenaked first datestolentowelnudeofficestrippedexhibitionistembarrassmentpoolbig erectionerectionsembarrassing erectionpublic nude erectionnaked in front of a crowdvideorecordedtiedrestrainedunable to covercollegeseniorpublic nudityhumiliationexhibitionsitexhibitionismfirst datenaked on a dateerectionpublic erectionerect penisvisible shaftarousal in publicnaked erection in publicuncoverednaked in public on a first date with a huge bonernude dateNude MaleNude FemaleNFNMNude modellingYoure NakedTeacherHard PenisErection while modellingprecumbonerhard dickabout to cumteasingnude musemale musemodelling nakednaked malenaked in schoolnaked in classarousalhard-onnaked for teacherembarrassed maleclothed female naked maleonly one nakedassisted exposureflirty girlsexcited classmateswagerbetlost betfantasyknightexhibitionsmcolleaguenaked in publicworkplacerurallibrarianembarrassed naked malesFarmFarmerAPHAverage dickaverage penisaverage cocklost betsbetsstripstripped in schoolstripped by classmatesnaked in front of everyonemassagehigh school nudephotophotoshootclasscoedexhibtionistPre-marital hand holdingnakeddinner nakednude modelnaked for a crowdnaked in front of crushshy posingembarrassed nude malenaked at schoolnaked outdoorsnaked in front of teacherraging public bonerNude outdoorserection in publicmale orgasmorgasm in front of everyonecumming in publicnude at dinnerclothed females nude malenipnude and aroused in publichigh schoolstreakingoutdoorsnuditynaked outsidecafesex at schoolfucking a crushfucking outdoorssex in publicmale nudewet and nakedpublic arousalaccidental public nudityBottomlesssudden nudityGrocery storestageedgingpublicmagicembarrassed erectionflinging precumthrobbing bonerAsian girlslegalHRmuseillustrationanxietyGymprincesscastlelobbyhotelFondlingSpankinghigh school girlsexcited girlsshy guythreat of exposureCasual NudityHome NudismNudismNudistHome NudistNaturismNaturistTopfreedomTopfreeToplessPublic ExposurePublic BonerBouncing PenisBouncing BallsBouncing BonerPrePre-CumMale NudityMale ExhibitionistMale ExhibitionismHeight DifferenceBarefootBare FeetFlashingclothed teacher nude studentnude in classoutdoor nudetowelwaiterpose nudedrawing your nude bodyoogling girlsnude in front of groupblack girlemo girlasian girlflirty teacherhardmake-outkissingcaughtnaked at the officeflirty classRISKYCLOTHES STOLENSHARED BEDRISKY ERECTIONRISKY BONERHARD COCKRomanceDatingCoupleNaked BoyfriendEmbarrassed Naked MaleZenraExposedStrippingClothed Female Nude MaleClothed Female Nakek MaleExposureHuge BoobsBig TitsLarge BreastsBustyBuxomSouthern BelleGirlfriendwatching you undressraging bonershy nudechoose to stripstripping for classEdgedRISKY NUDITYhandcuffpictureorgasm controlteacher crushalone with teacherworkout without clothesBarefoot teacherNude exercisenude in front of teachernude in schoolclassmates touchingmale arousedthrobbingnude in front of classassisted nudeshaftmale bodyembarassed arousalnude at workphotograheroiledarrogantexhbitionistteasedcumoralblow jobsex with teachersex in schoolAccidental NudityNude posingnaked teacherlife drawinghazingrushgamehandsyphotographyuncontrolled thustingstrokingaccidental cummingorgasm in classfootfetishbachelorette partypokersupportivenaked in the sunwet pantieswet bonercrossoverpicturescmnfgrindingbreast suckingprofessorMILFBoobiehugBreath SmotherMarshmallow HellBreastplayDirty Talkmagical kingdomqueenAsianGlassesHeadpatsBack RubsPublic Sexcum competetionteacher approved nudityoutdoor nude photoshootstrip gamereality tvvoyeursex during photoshootteacher giving headpublic sex with teacheroral in publicoral in classpenis sneaks into mouthphotographedmasturbationinterng stringshowtv showreality showcheerleadersmissing clothesenfonly maleAss SqueezeBreast Grabdripping erectionmale modelnude in art classcoffeelegally nudenude in officedeliveryoffice oonbossemployeestrip pokerorgasmpublic orgasmimposed orgasmWet spotwet penisVisible erectionfilmedphotographerspeedonaked in officeHugsHuggingSnugglingCuddlesLap SittingSitting in LapMommy DomSoft DomGentle DomBBWBlondeFrecklesTHICCcockringcock ringpenis measuringpenis measuredmeasuredmeasuringpenis sizepenile lengthpenis exposurenaked at dinnerfeetexposed arousalhuge erectionaroused in publicnaked and aroused in publicideassororityedgeoffice nudityswimsuitLatinaMexicanabondagenaked in front of strangerstouchy classmatesconcealment is futileclothed females naked malenaked in a crowdencouraged nakedashameddefeated shamenude guiltnude at schoolclothing breaknude in highschoolclothes falling offdisrobeclothing falls offaccidental nudeembarassing nude drawingswitchesstrokedEx-girlfriendskinnydippingdreammeasurementerectpantsedcocknaked in front of classthrobbing penisnude for everyonechoiceSubmissivepublic nudenaked on public beachunwanted orgasmboss makes you cumstripped by bosscrowd of onlookerscum in mouthcum spraycum tornadocum blizzardgiant orgasmclimaxcum on teachercum on classmatestvfacialsunblocksunscreenstreakphotocopyexhbitioinistcosplayroleplayFlat ChestSmall TitsNerd GirlRedheadblowjobdominationmodelworkstripped in publicnaked in front of classmatesundressing in classswimwearbargainShortstackCuddlingnaked on a first daterural nudeWet DreamMorning Wood